PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi10g04500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 665aa    MW: 75542 Da    PI: 5.2661
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi10g04500.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1791.3e-5561331128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtdeelv++yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratksgyWkatgkd++v
  Vradi10g04500.1   6 LPPGFRFHPTDEELVSYYLKRKINGRKIEL-EIIPEVDLYKCEPWDLPgKsLLPGKDLEWYFFSPRDRKYPNGSRTNRATKSGYWKATGKDRKV 98 
                      79****************************.99***************6434445667************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s ++ ++g+kktLv+y+grap+g +t Wvmheyrl
  Vradi10g04500.1  99 NS-QSCAIGMKKTLVYYRGRAPHGCRTGWVMHEYRL 133
                      *9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-654156IPR003441NAC domain
PROSITE profilePS5100561.2056156IPR003441NAC domain
PfamPF023653.5E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV SYYLKRKING RKIELEIIPE VDLYKCEPWD LPGKSLLPGK  60
DLEWYFFSPR DRKYPNGSRT NRATKSGYWK ATGKDRKVNS QSCAIGMKKT LVYYRGRAPH  120
GCRTGWVMHE YRLDETQCET NTGLQDAYAL CRVFKKTAVI PPKVGDQHYV NVTTSHANQI  180
IASDQSSSIN ELYSEGRGEV LESSNYFMSL DACPSSNINV NTYNINGGRR DNETTWSHFL  240
SEDLLNLPTT STCSFPNYGS MSYPPSKVDV ALECARMQHR FSMPPLQMQD LEFPQVGISK  300
LKMAQGSSSM SGTRNETDIL QEILSVAHAS QELINQSNYS SQPFMNANEN YAPHESDFTF  360
MVGTNYNHVN DMNTMGFVDK AWEDQNTRSI EIGDLDDGFK TENLKWVGMS SKDVGKSFME  420
EQQNIVPIDD ISNFQTNTEE NEMKVGFEKH SCNKEITDTE IDDFSMGFMN DEDPNENFLN  480
EENIDYSNPT NFDVVEETKT NHGMFVSTHQ VADTFFHQVA PSQTLKVQLN PVMGGNECIE  540
NARVSEGLSF FRKFKACVTG KLRKASTIGS AIEFIFALLL MHCVFVKEFV EDWKSELKNG  600
GNVYTMKRMR EAEESVRRNE EEKVWLIGMK YGKGFSMVLK KISIFLTISL ALFTMWANHI  660
IVDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-55215611168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi10g04500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517928.10.0NAC domain-containing protein 86
RefseqXP_022642946.10.0NAC domain-containing protein 86
TrEMBLA0A1S3VHU40.0A0A1S3VHU4_VIGRR; NAC domain-containing protein 86
STRINGXP_007146987.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-159NAC domain containing protein 28