PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi10g01040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 276aa    MW: 31406.6 Da    PI: 6.6221
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi10g01040.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.43.8e-25155202552
           RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      +++e+++k+F+ pi++AAk+++v+lT+LKr+CR+++I+RWPhRk+ksl
  Vradi10g01040.1 155 LEFEEIKKHFDVPINEAAKQMNVGLTMLKRRCRELNIMRWPHRKLKSL 202
                      89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.279141222IPR003035RWP-RK domain
PfamPF020422.4E-23155202IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MEFASEHDFP NFEIIPHTFA SCFFSAQLYP TDKAMMDVSL SPLEGFSGHD WTQQLPYSSK  60
QLCLNEFPDL ENLDLDFSLP PLGEDLEEVE QKPLNIIVVP EEGHCGREKG FGDALLAIEN  120
GSAICVKKEE VQNIEQMAVP SGSSGSKKKK KPCALEFEEI KKHFDVPINE AAKQMNVGLT  180
MLKRRCRELN IMRWPHRKLK SLQLLIENVK VMYPDMLVMS YELGLADEVP MLEKHKRLLE  240
KLPGLELCAK AKKLRQACFK ANYKRRRFMG MTLQA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi10g01040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022642692.10.0protein RKD4 isoform X1
TrEMBLA0A3Q0FKF40.0A0A3Q0FKF4_VIGRR; protein RKD4 isoform X1
STRINGXP_007136514.11e-159(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-37RWP-RK domain-containing protein