PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi10g00620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRF
Protein Properties Length: 569aa    MW: 61102.3 Da    PI: 8.4089
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi10g00620.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.56.4e-25202245144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Vradi10g00620.1 202 DPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVE 245
                      79***************************************998 PP

2QLQ53.29e-19137169234
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                      +FT aQ+ +L++Q+++yKy++a++PvP++Ll +
  Vradi10g00620.1 137 PFTSAQWRELERQAMIYKYMMASVPVPHDLLIP 169
                      8*****************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.0E-10136172IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.36137172IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.1E-13137169IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.739202246IPR014977WRC domain
PfamPF088792.0E-20203245IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MGEFGVPHTR KRSSSNNSGG SVVGLDVRVQ SPEALFHNKM TMMAHHNHHH RPLSSPFDND  60
SCAGDGDGPT AYMSFTNHIN LVSGASVLAP VIDGGCGAPA PVRTLQPFDI SPYTSPTTTS  120
STFKPSAGGM AASLGFPFTS AQWRELERQA MIYKYMMASV PVPHDLLIPT SLTPSSRSAC  180
SMNDPLLSLD GGFNLRLASG TDPEPGRCRR TDGKKWRCSR DVAPNHKYCE RHMHRGRPRS  240
RKPVEVNTKT ATPTSINNNT HQIKRPRHEC NPFPSIPDVT VAISNPTSRK HGPSPHFLPS  300
STTLPYLESP LSLANFGYKA ANLDSMASVS ANKEPRGLDW MLNGDPISLG ASDSEWQSLM  360
HHKVGLSSES SCNNPQPQYL NSFTLYNTGL DQQNRRHPMF LNPLVVPMEN LQAEKPRGFI  420
DAWSNAETGE NNGTSNSKNS TASIGKLSLS SLDLSMGGGG VNEDVGNVNI GLGLMDTKIS  480
LSNWVNPAPW VGSTLGGPLA EVLRSSTVTA TTNERSSNTD VESNSPSGVL QKTLVSLSDS  540
SSNSSPRVAA SSRANSEMAL LRFQPNVN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi10g00620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517093.10.0growth-regulating factor 2 isoform X1
TrEMBLA0A1S3VFF40.0A0A1S3VFF4_VIGRR; growth-regulating factor 2 isoform X1
STRINGXP_007136458.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.16e-38growth-regulating factor 7