PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi09g09920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 827aa    MW: 90339.1 Da    PI: 5.9404
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi09g09920.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.6e-21132187156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Vradi09g09920.1 132 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 187
                      688999***********************************************999 PP

2START207.55.2e-653395641206
                      HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                      ela++a++elvk+a+ +ep+Wv+ +    e+ n +e+ ++f++  +     + +ea+r+ g+v+ ++  lve+l+d + +W e+++    + +t
  Vradi09g09920.1 339 ELALAAMDELVKMAQTGEPLWVRNVeggrEIMNHEEYARTFTPCIGlrpngFVSEASRENGMVIINSLALVETLMDAN-RWAEMFPciiaRTST 431
                      5899*************************************99998********************************.*************** PP

                      EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
            START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwv 167
                      +evis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+ds ++ +   s +v +++lpSg+++++++ng+skvtwv
  Vradi09g09920.1 432 TEVISNGingtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDSIRESSGaPSTFVNCRRLPSGCVVQDMPNGYSKVTWV 525
                      *************************************************************9999999************************** PP

                      E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      eh++++++++h+++r+ ++sg+ +ga++wvatlqrqce+
  Vradi09g09920.1 526 EHAEYDESQIHQVYRPSLNSGMGFGAQRWVATLQRQCEC 564
                      *************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-20118189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-21119189IPR009057Homeodomain-like
PROSITE profilePS5007117.216129189IPR001356Homeobox domain
SMARTSM003899.9E-18130193IPR001356Homeobox domain
CDDcd000861.34E-18131189No hitNo description
PfamPF000461.4E-18132187IPR001356Homeobox domain
PROSITE patternPS000270164187IPR017970Homeobox, conserved site
PROSITE profilePS5084844.059330567IPR002913START domain
SuperFamilySSF559612.06E-34331564No hitNo description
CDDcd088759.73E-124334563No hitNo description
SMARTSM002341.8E-48339564IPR002913START domain
PfamPF018522.0E-56339564IPR002913START domain
SuperFamilySSF559614.4E-21591819No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 827 aa     Download sequence    Send to blast
MSFGGFLENK SGSGAARHDL LDIPYNNVTT TNHTNTNEDD RMPFGAISQP RLVTTTTPTL  60
AKSMFNSPGL SLALQQTNID GQEDVNRMVE NSFEPNGLRR SREEEHESRS GSDNIDGASG  120
DEQDAADNPP RKKRYHRHTP QQIQELEALF KECPHPDEKQ RLELSKRLCL ETRQVKFWFQ  180
NRRTQMKTQL ERHENTLLRQ ENDKLRAENM SIRDAMRNPM CSNCGGPAII GEISLEEQHL  240
RIENARLKDE LDRVCALTGK FLGRPVSSLP NSSLELGVGG NGFGGISIGT TLPLGQDFGM  300
GMSMSVSNNP LAMVSPSSTR PTSVVGGFDR SMERSMFLEL ALAAMDELVK MAQTGEPLWV  360
RNVEGGREIM NHEEYARTFT PCIGLRPNGF VSEASRENGM VIINSLALVE TLMDANRWAE  420
MFPCIIARTS TTEVISNGIN GTRNGALQLM HAELQVLSPL VPVREVNFLR FCKQHAEGVW  480
AVVDVSIDSI RESSGAPSTF VNCRRLPSGC VVQDMPNGYS KVTWVEHAEY DESQIHQVYR  540
PSLNSGMGFG AQRWVATLQR QCECLAILMS SAAPSRDHSA ITAGGRRSMV KLAQRMTNNF  600
CAGVCASTVH KWNKLNPGNV DEDVRVMTRK SVDDPGEPPG IVLSAATSVW LPVSPQRLFD  660
FLRDERLRSE WDILSNGGPM QEMAHIAKGQ DHGNCAINSS QSSMLILQET CIDEAGSLVV  720
YAPVDIPAMH VVMNGGDSAY VALLPSGFAI VPDGPGSRGS QNGPTAATNG GDNGAARVSG  780
SLLTVAFQIL VNSLPTAKLT VESVETVNNL ISCTVQKIKA ALHCES*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi09g09920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014516480.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_014516481.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_022641691.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S3VDP60.0A0A1S3VDP6_VIGRR; homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
STRINGXP_007134961.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]