PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi09g08990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GeBP
Protein Properties Length: 258aa    MW: 29438.9 Da    PI: 10.2748
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi09g08990.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57390.32.3e-2838132297
           DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                      lfqr+ws eDe+++L+G+ +f +ktg++p+ +idaf++f+kks++++vs++ql +KirrLKkKf++ ++k+k+g  p+  + hd   +  skki
  Vradi09g08990.1  38 LFQRIWSAEDELSILKGIPEFISKTGQEPYWHIDAFHNFIKKSLHVEVSSHQLKDKIRRLKKKFETYEAKKKKGILPR-LRFHDGVLYAQSKKI 130
                      69********************************************************************77776655.5789*********** PP

           DUF573  96 Wg 97 
                      Wg
  Vradi09g08990.1 131 WG 132
                      *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.9E-2539132IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MRKKPKQRPT PKPAEAPSPS VANDKTEEDG TGGQAKVLFQ RIWSAEDELS ILKGIPEFIS  60
KTGQEPYWHI DAFHNFIKKS LHVEVSSHQL KDKIRRLKKK FETYEAKKKK GILPRLRFHD  120
GVLYAQSKKI WGERATELVE KPKPLAKTKT QKKESEAKAK VPTQKKESEA KTKVPGQPSA  180
SESGDVSLLY SNISCFKELD EDEMKRGLTL IEESKRKELE RRWKVLQYSE MELLVNRSLL  240
IGEQIKLISE ALQSSNN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
117RKKPKQR
218RKKPKQRP
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi09g08990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-131AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014515080.11e-179STOREKEEPER protein-like
TrEMBLA0A1S3V9Z71e-177A0A1S3V9Z7_VIGRR; STOREKEEPER protein-like
STRINGXP_007151503.11e-91(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.15e-20DNA-binding storekeeper protein-related transcriptional regulator