PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi08g19290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family bHLH
Protein Properties Length: 246aa    MW: 27886.7 Da    PI: 7.6427
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi08g19290.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH36.96.4e-1274126155
                      CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
              HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                      +++ h e+Er+RR+++ +  + Lr+llP ++    +K s ++   +Av+YI++Lq
  Vradi08g19290.1  74 KKMVHREIERQRRQEMATLHASLRSLLPLPF--IRGKRSMSDQMNEAVNYINHLQ 126
                      6889*************************86..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474592.49E-1272145IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.1673125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.4E-1074144IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.29E-874130No hitNo description
PfamPF000104.2E-974126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.004279131IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MFPLQRGNEL VIQFSNALQP QHKISKDLIL DHHNTDNSPL VAYSDKEVRT SRPNQLFYAP  60
ETSHANSAEE EYAKKMVHRE IERQRRQEMA TLHASLRSLL PLPFIRGKRS MSDQMNEAVN  120
YINHLQKNIK ELSEKRDKLK KKVAINSSLE SRENKHESCG FTVRQNSSGA VGIEISGLSE  180
EGVSLSKLLE LLLEEGLEVF CCLSTKVDGR LLHSLQCEVV NSDTVDLSEL RRKFSNVVPS  240
FRVSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-180AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014513050.11e-180PREDICTED: transcription factor bHLH118-like
TrEMBLA0A0L9U0531e-158A0A0L9U053_PHAAN; Uncharacterized protein
STRINGGLYMA10G38630.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51780.16e-30bHLH family protein