PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi08g19030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 794aa    MW: 87196.1 Da    PI: 5.7404
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi08g19030.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.32e-2168123156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r +L+k+lgL+ +qVk+WFqNrR+++k
  Vradi08g19030.1  68 KKRYHRHTPHQIQELESFFKECPHPDEKQRLDLSKRLGLENKQVKFWFQNRRTQMK 123
                      688999***********************************************999 PP

2START161.65.8e-512785272206
                      HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                      la++a++el+k+ +ae+p+W ks     e  n +e+ ++f++  +     + +ea r++g+v+ ++  lve+l+d + +W e+++    +a  l
  Vradi08g19030.1 278 LALAAMEELLKMTQAESPLWIKSLdgekEVFNHEEYARSFSPCIGpkpngYVTEATRETGIVIINSLALVETLMDAN-RWAEMFPsmiaRAINL 370
                      6899********************876666689*******998889*******************************.*******99999999* PP

                      EEECTT................................EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSE CS
            START  83 evissg................................galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvv 143
                      +vis+g                                    +m ae q+lsplvp R + f+R+++q+ +g+w++vdvS+d+  +  + ++++
  Vradi08g19030.1 371 DVISNGmggtrngalqvvrfftvymldfvlifagtddqDYTFQMHAEVQLLSPLVPvRQVRFIRFCKQHAEGVWAVVDVSIDVGHDAANAQPFM 464
                      ***********************************9955556889999**************************************999***** PP

                      E-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 144 RaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       +++lpSg+++++++ng+skvtw+eh++++++ +h+l+r+l++sg+ +ga +w atlqrqce+
  Vradi08g19030.1 465 SCRRLPSGCIVQDMPNGYSKVTWLEHWEYDESGVHQLYRPLLSSGVGFGAHRWIATLQRQCEC 527
                      *************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-2052125IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-2254119IPR009057Homeodomain-like
PROSITE profilePS5007117.68665125IPR001356Homeobox domain
SMARTSM003892.3E-1966129IPR001356Homeobox domain
CDDcd000863.54E-1967125No hitNo description
PfamPF000464.4E-1968123IPR001356Homeobox domain
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PROSITE profilePS5084840.04268530IPR002913START domain
SuperFamilySSF559611.09E-28270378No hitNo description
CDDcd088751.00E-113272526No hitNo description
SMARTSM002341.3E-23277527IPR002913START domain
PfamPF018528.7E-42278527IPR002913START domain
SuperFamilySSF559611.09E-28412527No hitNo description
SuperFamilySSF559613.21E-21555787No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MQNSSSFSYS NQRKMEGPSE MGLIGENFDA GLMGRMRDDE YESRSGSDNF DGVSGDDQDG  60
GDDQPQRKKR YHRHTPHQIQ ELESFFKECP HPDEKQRLDL SKRLGLENKQ VKFWFQNRRT  120
QMKTQLERHE NIMLRQENDK LRAENSLMKE AMSNPVCNSC GGPAIPGQIS FEEHQIRIEN  180
ARLKDELNRI CALANKFLGK PISSMTSPMA LPTSNSGLEL GIGRSGLGGS STLGTPLPMG  240
LDLGDGVLGT QTAMPGIRPS LGLMGNEVQL ERSMLIDLAL AAMEELLKMT QAESPLWIKS  300
LDGEKEVFNH EEYARSFSPC IGPKPNGYVT EATRETGIVI INSLALVETL MDANRWAEMF  360
PSMIARAINL DVISNGMGGT RNGALQVVRF FTVYMLDFVL IFAGTDDQDY TFQMHAEVQL  420
LSPLVPVRQV RFIRFCKQHA EGVWAVVDVS IDVGHDAANA QPFMSCRRLP SGCIVQDMPN  480
GYSKVTWLEH WEYDESGVHQ LYRPLLSSGV GFGAHRWIAT LQRQCECLAI LMSSSISSDD  540
HTALSQAGRR SMLKLAQRMT SNFCSGVCAS SARKWDMLHI GTLGDDMKVM TRKNVDDPGE  600
PPGIVLSAAT SVWMPVSRQR VFDFLRDERL RSEWDILSNG GPMQEMVHIA KGQGHGNCVS  660
LLRANAVNAN DSSMLILQET WMDASCSVVV YAPVDVQSLN VVMSGGDSAY VALLPSGFAI  720
VPDGHCNNSS SSCNGTMQKG GGGEESGGSL LTVGFQILVN SLPTAKLTVE SVDTVNNLIS  780
CTIQKIKGAL RVA*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi08g19030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014514419.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_022641349.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S3V8F60.0A0A1S3V8F6_VIGRR; homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
STRINGXP_007143378.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]