PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi08g18730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 1040aa    MW: 115186 Da    PI: 5.7962
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi08g18730.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.51.3e-28633683252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Vradi08g18730.1 633 EKSISLEVLQRYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 683
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.53622703IPR003035RWP-RK domain
PfamPF020421.9E-25636683IPR003035RWP-RK domain
SuperFamilySSF542778.18E-249401029No hitNo description
PROSITE profilePS5174525.4389441026IPR000270PB1 domain
SMARTSM006662.3E-259441026IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.1E-279441026No hitNo description
PfamPF005641.7E-199441025IPR000270PB1 domain
CDDcd064071.68E-389451025No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1040 aa     Download sequence    Send to blast
MSESEEENTD CVPRSKPAEE GGCTMDFDLD LETSWPLDHM AFGSNPMSPF LFSSNSDQPY  60
SPLWAFSDGE DTKFPASAFS DCHKIFPCDS NSIAEKPEEN DDNKKILPPL APMPPLENVG  120
GYCVIKERMT QALRYFKELT ELNVLAQVWA PVRNGNRYVL TTSGQPFVLD PHSNGLHQYR  180
TVSLMYTFAV DGENDGSLGL PGRVFQQKLP EWTPNVLYYS SKEYPRRDHA QHYNVRGSLA  240
LPVFEPALQS CIGVLELIMT SQKINYAPEV DKICKALEVG FLLTWLIMPI ICSYSKFEEF  300
GNFGPSIHSG DLTIRHGASP SVILLLFIIL TLCSHRYNLA MLLNQICNEG RQNALSEILE  360
ILTVVCETHN LPLAQTWIPC KHRSVLAQGG GVKKICSSFD GSCMGKVCMS TTDVAFYIID  420
AHLWGFREAC VEHHLQQSQG VAGRAFLSHS MCFCSNITQF CKTDYPLVHY ALMFGLTSCF  480
AICLRSSHTG TDDYVLEFFL PPRITDFHEQ KTLLASILAT MKQHFQSLKI ASGVELEDGS  540
VEIIEATIER IHTRLESIPI APSIRSPPRP DTSPNMEEEG PLDPSEQHIL MYCNGTNHGS  600
NLSDQAGGKI DHMITLETKT SKKPLERKRG KTEKSISLEV LQRYFAGSLK DAAKSLGVCP  660
TTMKRICRQH GISRWPSRKI NKVNRSLSKL KRVIESVQGA EGAFGLNSLG TSPLPIAVGS  720
LPEPSTPDKF SQPVSMNIRP SEPQMKVNEL NASKELETNR EAGMEDQLVG GRIHNIERVT  780
NDKRGFTQEI GKEPKRTRTG SGSSEDSTNP PSHGSWHDSI PNESSHVKDL FITSNHDQCA  840
VLRRSPESTL QPATNTPNQS TPFRMPEFVA AELQEPFGGM LIEDAGSSKD LRNLCPSVAE  900
AILEDLVPEA CGTNPPALDL SPKQSMGAPN KTVTPFAATK EMKTVTIKAT YREDIIRFRV  960
SLTCGIVELK EEVAKRLKLE MGTFDIKYLD DDHEWVLIAC DADLQECMDV SRSSGSNIIR  1020
VLVHDMTSNL GSSCESSGE*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi08g18730.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014513884.10.0protein NLP6
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A1S3V6X30.0A0A1S3V6X3_VIGRR; protein NLP6
STRINGXP_007143431.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  2. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  3. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  4. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  5. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  6. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  7. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  8. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  9. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  10. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  11. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  12. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]