PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi08g15530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 172aa    MW: 18679.9 Da    PI: 6.5176
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi08g15530.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB176.52.5e-5526119295
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdrflPian+srimkk lP n+ki+kdak+t+qecvsefisfvtseas+kcq+ekrktingddllwa+atlGfedy+eplkvyl++yre ++
  Vradi08g15530.1  26 REQDRFLPIANISRIMKKGLPPNGKIAKDAKDTMQECVSEFISFVTSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYREGDT 119
                      89****************************************************************************************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.0E-5223122IPR009072Histone-fold
SuperFamilySSF471131.35E-3928124IPR009072Histone-fold
PfamPF008085.5E-293195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-215977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.7E-217896No hitNo description
PRINTSPR006151.7E-2197115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MSDAPASPSH ESGGEQSPRA FSSGAREQDR FLPIANISRI MKKGLPPNGK IAKDAKDTMQ  60
ECVSEFISFV TSEASEKCQK EKRKTINGDD LLWAMATLGF EDYIEPLKVY LARYREGDTK  120
GSARGGDGSA RPDQVGLAGQ NSQLVHQGSL NYISLQVQPQ HLVIPSMQSH E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4826116292Transcription factor HapC (Eurofung)
4g92_B5e-4826116292Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi08g15530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7755291e-141FJ775529.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1a) mRNA, complete cds.
GenBankFJ7755301e-141FJ775530.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014512284.11e-124nuclear transcription factor Y subunit B-1 isoform X2
RefseqXP_022641061.11e-124nuclear transcription factor Y subunit B-1 isoform X2
SwissprotQ8VYK46e-77NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A1S3V2A91e-123A0A1S3V2A9_VIGRR; nuclear transcription factor Y subunit B-1 isoform X2
STRINGXP_007144163.11e-120(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.33e-79nuclear factor Y, subunit B8
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]