PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi08g12690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YC
Protein Properties Length: 150aa    MW: 16883.2 Da    PI: 4.6157
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi08g12690.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC127.83.8e-4017230101
            NF-YC  30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                      +kadedv+misaeaPv++++ace+fileltlrsw+h+eenkr+tl+k+diaaa+trtdifdflvdivpr++ 
  Vradi08g12690.1   1 MKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRKTLQKNDIAAAITRTDIFDFLVDIVPREDY 72 
                      9********************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.8E-15154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471136.04E-24169IPR009072Histone-fold
Gene3DG3DSA:1.10.20.106.1E-31169IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MKADEDVRMI SAEAPVIFAR ACEMFILELT LRSWNHTEEN KRKTLQKNDI AAAITRTDIF  60
DFLVDIVPRE DYKDEVLASM PRGAVPVTAP PEALPYCYMP PQHAQVGAAG VMMSNKPVMD  120
PYAQQSHQYN MAQQMWPQPP EQQQSSSDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_B3e-321692997NF-YC
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014511829.11e-109PREDICTED: nuclear transcription factor Y subunit C-3
SwissprotQ8L4B28e-60NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
SwissprotQ9ZVL35e-60NFYC3_ARATH; Nuclear transcription factor Y subunit C-3
TrEMBLA0A0L9VJ031e-107A0A0L9VJ03_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SQI31e-107A0A0S3SQI3_PHAAN; Uncharacterized protein
STRINGGLYMA20G37620.19e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08970.42e-60nuclear factor Y, subunit C9