PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi08g04700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 220aa    MW: 25362.8 Da    PI: 10.5947
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi08g04700.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1642e-5192188197
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqd+++Pianv rim+k+lPa+akis++aket+qecvse+isf+t+ea+d+cqre+rkt++++d+lwa+++lGf+dy+++l++yl++yr+ e
  Vradi08g04700.1  92 VREQDQYMPIANVLRIMRKILPAHAKISDEAKETIQECVSEYISFITAEANDRCQREQRKTVTAEDVLWAMGKLGFDDYAQSLSIYLNRYRQSE 185
                      69******************************************************************************************** PP

            NF-YB  95 gek 97 
                      g++
  Vradi08g04700.1 186 GDR 188
                      997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.5E-4789193IPR009072Histone-fold
SuperFamilySSF471132.02E-3595192IPR009072Histone-fold
PfamPF008081.0E-2498162IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.9E-15126144No hitNo description
PRINTSPR006153.9E-15145163No hitNo description
PRINTSPR006153.9E-15164182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0033613Molecular Functionactivating transcription factor binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MKSGAVKQGL RSNTTKSWSG RKKAKSWRGQ TSPKVEYDQS WRDQTKAKSR RGQRRPKAKH  60
NQKLERPNKV EDRRVKDKLS HERPNQGAMA GVREQDQYMP IANVLRIMRK ILPAHAKISD  120
EAKETIQECV SEYISFITAE ANDRCQREQR KTVTAEDVLW AMGKLGFDDY AQSLSIYLNR  180
YRQSEGDRMS VRRAPTCVPP MEMNPPYQPY PPHVRDSVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A3e-5487183197NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi08g04700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014511494.15e-90nuclear transcription factor Y subunit B-9-like
TrEMBLA0A1S3V0211e-88A0A1S3V021_VIGRR; nuclear transcription factor Y subunit B-9-like
STRINGXP_007145389.11e-77(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.23e-57nuclear factor Y, subunit B6