PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g27710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 310aa    MW: 34713.9 Da    PI: 7.6459
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g27710.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.18.1e-54121371128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL +kv++ +++  +v++ vd++k+ePwdLp k++ +ekewyfFs +d+ky+tg r+nrat+sgyWk+tgkdke++ 
  Vradi07g27710.1  12 LPPGFRFHPTDEELITYYLLRKVSDVSFTS-KVVAVVDLNKSEPWDLPGKASMGEKEWYFFSLKDRKYPTGLRTNRATESGYWKTTGKDKEIFG 104
                      79*************************999.89***************988999**************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g l+g+kktLvfy grap+gek++Wvmheyrl
  Vradi07g27710.1 105 -GGVLIGMKKTLVFYMGRAPRGEKSNWVMHEYRL 137
                      .*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-648158IPR003441NAC domain
PROSITE profilePS5100560.28712158IPR003441NAC domain
PfamPF023654.9E-2913137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGEVKNNMEE NLPPGFRFHP TDEELITYYL LRKVSDVSFT SKVVAVVDLN KSEPWDLPGK  60
ASMGEKEWYF FSLKDRKYPT GLRTNRATES GYWKTTGKDK EIFGGGVLIG MKKTLVFYMG  120
RAPRGEKSNW VMHEYRLQNK QPYRSSKEEW VICRVFQKNS APKKAQQTSS SQPSQESPSS  180
MANEFGDADL PNLNSIGNSS SVAAQIYNSG DPSNVSTNMN LNMNWASATE LPSLPWPSGL  240
MLNPNLSVNS LLLRALQLRS TYQQREAATG DHFATYVPHN NIGTDDLSVS ASSRGLELQE  300
QPFNMDSIW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-571116416171NO APICAL MERISTEM PROTEIN
1ut4_B2e-571116416171NO APICAL MERISTEM PROTEIN
1ut7_A2e-571116416171NO APICAL MERISTEM PROTEIN
1ut7_B2e-571116416171NO APICAL MERISTEM PROTEIN
3swm_A2e-571116419174NAC domain-containing protein 19
3swm_B2e-571116419174NAC domain-containing protein 19
3swm_C2e-571116419174NAC domain-containing protein 19
3swm_D2e-571116419174NAC domain-containing protein 19
3swp_A2e-571116419174NAC domain-containing protein 19
3swp_B2e-571116419174NAC domain-containing protein 19
3swp_C2e-571116419174NAC domain-containing protein 19
3swp_D2e-571116419174NAC domain-containing protein 19
4dul_A2e-571116416171NAC domain-containing protein 19
4dul_B2e-571116416171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi07g27710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014506790.10.0NAC domain-containing protein 100
TrEMBLA0A1S3ULB50.0A0A1S3ULB5_VIGRR; NAC domain-containing protein 100
STRINGXP_007160376.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-103NAC domain containing protein 58