PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g25390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 133aa    MW: 15027.9 Da    PI: 5.3432
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g25390.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB172.25.6e-5419114297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdr+lPianv+rimk++lP nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++wala+lGf+dy++pl+ yl++yrele 
  Vradi07g25390.1  19 REQDRLLPIANVGRIMKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALASLGFDDYADPLRRYLHRYRELEL 112
                      89******************************************************************************************98 PP

            NF-YB  96 ek 97 
                      ++
  Vradi07g25390.1 113 DR 114
                      87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.5E-5212127IPR009072Histone-fold
SuperFamilySSF471138.38E-3921129IPR009072Histone-fold
PfamPF008082.8E-272488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-185270No hitNo description
PROSITE patternPS0068505571IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.7E-187189No hitNo description
PRINTSPR006151.7E-1890108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MMVDNVGGSS SNPENSGIRE QDRLLPIANV GRIMKQILPP NAKISKESKE TMQECVSEFI  60
SFVTSEASEK CRKERRKTVN GDDICWALAS LGFDDYADPL RRYLHRYREL ELDRTAIQER  120
GNSPSKDKDA EF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-4518109192Transcription factor HapC (Eurofung)
4g92_B8e-4518109192Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi07g25390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014506750.17e-95nuclear transcription factor Y subunit B-5-like
SwissprotO822481e-55NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A1S3UL772e-93A0A1S3UL77_VIGRR; nuclear transcription factor Y subunit B-5-like
STRINGXP_007154257.18e-88(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.16e-50nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]