PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g21140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 678aa    MW: 74810.8 Da    PI: 6.0718
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g21140.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like72.94.8e-23209262155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k rl+W +eLH++F+ a++qL  ++kA Pk+il+lm+++gL++e+v+SHLQk+Rl
  Vradi07g21140.1 209 KSRLVWDTELHNKFLAAINQL-EIDKAFPKKILDLMNIDGLSRENVASHLQKFRL 262
                      68*******************.9*******************************8 PP

2Response_reg791.7e-26131211109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+++ + +l+++l+k +y +v++++++ +ale+l++++  +Dl++ D++mp+mdG++ll++   e  +lp+i+++++g+ e + + + +
  Vradi07g21140.1  13 VLAVDDDRTYLTVLENLLRKCQY-NVTATTQSVKALEMLRKNRneFDLVISDVNMPEMDGFKLLQQVGLET-DLPVIMLSGYGDRERVMKGVIY 104
                      799********************.***************999999**********************7766.8********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga dfl+Kp+ ++el +
  Vradi07g21140.1 105 GACDFLTKPVRIQELQN 121
                      **************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.2E-1331674IPR017053Response regulator B-type, plant
SuperFamilySSF521722.7E-3410133IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.9E-4010144No hitNo description
SMARTSM004488.8E-3011123IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.65412127IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.5E-2413121IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.23E-2614126No hitNo description
Gene3DG3DSA:1.10.10.601.2E-23206266IPR009057Homeodomain-like
SuperFamilySSF466891.25E-16207266IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-21209262IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MVEEDHFPVG LRVLAVDDDR TYLTVLENLL RKCQYNVTAT TQSVKALEML RKNRNEFDLV  60
ISDVNMPEMD GFKLLQQVGL ETDLPVIMLS GYGDRERVMK GVIYGACDFL TKPVRIQELQ  120
NIWQHVVRRK IDSKDKNKTA SEEKDCSIAC KFANEEEPCT VAGECSQALA PKTNADQNIK  180
VDHKRKERCE VEEMEEDDKE NDEPSNQKKS RLVWDTELHN KFLAAINQLE IDKAFPKKIL  240
DLMNIDGLSR ENVASHLQKF RLGLKKPNPY HRMGSVDCFR TSSESGAMLS TTLPSYAYAP  300
GGRFSVLNSP SCLNTRGMNS SAIVQASQSR NINSSSIKTH GNMHSSMFSA NQTSSLLQGI  360
PTSMEANHFK PNNSAAGIRR FNPLDHSAAL KDFSSFSENI ATVRNAANIS LPGLSNNHLL  420
FQGISQLKHH SEAFRNHSSF GAAAVKTQSF YPNSCGYSKM GDDYNNKRWQ EAAPISTCPS  480
NTSAVSNVFN NDQLLQHNFK LSSSNFCSRN SPVGFSSSVP LEDDVLGEML HQEGLLGNIL  540
LASCYTKNNQ GGCSKDTSQT FNSINPVISP NGGTSPLGHS YEQNSTVDNN RIDASLVGQM  600
NGVNPSITMC SEGENFYSMK SNDAYVLQSM KSGEGLMQNS LESLDDILNG IDEQVFDQIF  660
LLAISSSFNP ALNGSII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-23207266362ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi07g21140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022639540.10.0two-component response regulator ARR12 isoform X1
TrEMBLA0A3Q0F6930.0A0A3Q0F693_VIGRR; Two-component response regulator
STRINGXP_007154913.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-91response regulator 12