PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g17810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family bZIP
Protein Properties Length: 164aa    MW: 18544.8 Da    PI: 9.6583
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g17810.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.95.9e-1555114463
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      +++ +r+ +NRe+ArrsR RKk++ie L+  v+ L++ N++L +++  l +  ++  +++
  Vradi07g17810.1  55 DRKKKRMFSNRESARRSRMRKKQQIEVLQYHVDHLQTLNHQLSQKIIYLLECNQQIHQQN 114
                      7899****************************************9988888888877776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-1352116IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.25454117IPR004827Basic-leucine zipper domain
PfamPF001705.6E-1355114IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-1256114No hitNo description
SuperFamilySSF579592.31E-1156107No hitNo description
CDDcd147026.54E-1357105No hitNo description
PROSITE patternPS0003605974IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
METAEGHFPF FCSQLHLPSN THDPIQIPLH KPSPNTSSNS NNNNNSDEAK ALLDDRKKKR  60
MFSNRESARR SRMRKKQQIE VLQYHVDHLQ TLNHQLSQKI IYLLECNQQI HQQNSQLKEK  120
VSSLQVVLSD LLVPAAGAEQ PHHIPNGFPA EPSSTRPIAS SRT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi07g17810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014508438.11e-116basic leucine zipper 43 isoform X1
RefseqXP_022639364.11e-116basic leucine zipper 43 isoform X1
RefseqXP_022639365.11e-116basic leucine zipper 43 isoform X1
RefseqXP_022639366.11e-116basic leucine zipper 43 isoform X1
TrEMBLA0A1S3UQT01e-115A0A1S3UQT0_VIGRR; basic leucine zipper 43 isoform X1
STRINGXP_007155196.12e-82(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.13e-24basic leucine-zipper 70