PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g17680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 555aa    MW: 60780.7 Da    PI: 7.3884
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g17680.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1352.3e-42174249277
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      Cqv gC++dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Vradi07g17680.1 174 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTATVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 249
                      **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-33168235IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.573171248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-39172251IPR004333Transcription factor, SBP-box
PfamPF031102.1E-31174247IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MESWSFVPEE KESVSNEALS PPNTLGRTIN SFLGWELKTP CGFSNDMLGL GQHPIENQGF  60
EELGFPEMLG KHLSDDLIAS VSSRKVDAGR HQQHQHSDRI TGTVVDAPSG FSQRGDSNSK  120
LSNSNSLIDL KLGRFADHGD AIDAGFSKVL SSSESSTPPK RVRVSGVHSQ TAYCQVYGCN  180
KDLSSCKDYH KRHKVCEVHS KTATVIVNGI EQRFCQQCSR FHLLAEFDDG KRSCRKRLAG  240
HNERRRKPQM GIHPGKSGRL LQPCGDSRFQ GSMLTSSFIR PEMLPSGVMC SEKYGVSSFW  300
RPIKAEHGTG FRHLSSMPVS NGHPQSRSLF PSYNGKQFPF LHENCATSTT GSIFCESNSH  360
YPPALGAQNS GLRPLFQDTI GNEDFNVFDT ASTVQGLSGI SDSCCALSLL SSQSQNSSSQ  420
SSGIPLAHSM VIPSGHGHHY NMSQVSEKIG ISSQTSSSRV SDSFPSELNH ADGSHLSPVL  480
ISDHNDIVNF DMADGIFHGS EFMNVKDRLP CEDGATIDLL QLSSQLQRVE HERQSLQEKG  540
RASCEGHLRK RRPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-291742471184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi07g17680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510370.10.0squamosa promoter-binding-like protein 6
RefseqXP_022639361.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A1S3UWE80.0A0A1S3UWE8_VIGRR; squamosa promoter-binding-like protein 6
STRINGXP_007155210.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-51SBP family protein