PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g17040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 288aa    MW: 33796.3 Da    PI: 4.5082
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g17040.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.81.6e-26138187352
           RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++s e++s+yF++pi++AA+eL+v+lT+LK++CR++GI+RWPhRk+ sl
  Vradi07g17040.1 138 RKLSRETISEYFYMPITQAARELNVGLTLLKKRCRELGIRRWPHRKLMSL 187
                      6899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.132122207IPR003035RWP-RK domain
PfamPF020422.4E-21140187IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MIMDSHPLMS WSSYYQIEEK PLPFTCQFSY SENSEVYPPP LHDLPIQDCY QGAVPLTEYY  60
PSDPLYETLA IELTPTLRAD CDFYDISKEL SVWNEVNAVF DSEVDLLFRN KEESLKEMVD  120
DSKVNEGREE ITNPRNSRKL SRETISEYFY MPITQAAREL NVGLTLLKKR CRELGIRRWP  180
HRKLMSLQTL INNVQELLKE EGPESEEKLR FAIETLEKEK KLLEEMPDIE LEDNTKRLRQ  240
ACFKANYKKR KLGQREPDCS SWSGVMSEYN NESEEELDMK YLISQLV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi07g17040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-167AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022638516.10.0protein RKD2-like
TrEMBLA0A3Q0F4T80.0A0A3Q0F4T8_VIGRR; protein RKD2-like
STRINGXP_007155308.11e-151(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-44RWP-RK domain-containing protein