PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g13210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TALE
Protein Properties Length: 288aa    MW: 32616.8 Da    PI: 6.8392
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g13210.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.9e-082362692154
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      k +yp+++++++L +++gL+ +q+ +WF N+R +
  Vradi07g13210.1 236 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 269
                      469*****************************87 PP

2ELK25.53e-09190211122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK +L++++++++ ++++E++
  Vradi07g13210.1 190 ELKIELKQGFKSRIEDVREEIL 211
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-182569IPR005540KNOX1
PfamPF037902.0E-172767IPR005540KNOX1
SMARTSM012564.6E-2379134IPR005541KNOX2
PfamPF037911.1E-1683133IPR005541KNOX2
PROSITE profilePS512139.132190210IPR005539ELK domain
PROSITE profilePS5007111.645210273IPR001356Homeobox domain
SuperFamilySSF466892.95E-16212277IPR009057Homeodomain-like
SMARTSM003893.4E-11212277IPR001356Homeobox domain
CDDcd000868.14E-12213274No hitNo description
Gene3DG3DSA:1.10.10.601.4E-25217275IPR009057Homeodomain-like
PfamPF059201.0E-17230269IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MQEAGLAMNM LSAEVSAAAA DHHHRQLKAD IATHPLYEQL LAAHVSCLRV ATPIDQLPLI  60
DAQLSHFNNL LRSYASHHSH SHSHDRQELD NFMTQYLIVL CALKEQLQQH VRVHAVEAVM  120
ACRDIESTLQ ALTGVSLGEG SGATMSDDEE DFQMDGSLDQ SSAEGHDMMG FGPLLPTESE  180
RSLMERVRQE LKIELKQGFK SRIEDVREEI LRKRRAGKLP GDTTSVLKAW WQQHAKWPYP  240
TEDDKAKLVE ETGLQLKQIN NWFINQRKRN WHSNSQSVTS LKSKRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A6e-13213269864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1266286RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtPossible developmental regulator.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi07g13210.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By wounding; up to 7-fold increase.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939000.0BT093900.1 Soybean clone JCVI-FLGm-17N4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507374.10.0homeobox protein HD1
RefseqXP_017425423.10.0PREDICTED: homeobox protein HD1-like
SwissprotP466061e-160HD1_BRANA; Homeobox protein HD1
TrEMBLA0A0S3R5V70.0A0A0S3R5V7_PHAAN; Uncharacterized protein
TrEMBLA0A1S3UN550.0A0A1S3UN55_VIGRR; homeobox protein HD1
STRINGXP_007155574.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-161KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Boivin R,Hamel F,Beauseigle D,Bellemare G
    Stage-specific transcription of the homebox gene Bnhd1 in young tissues and flowers of Brassica napus.
    Biochim. Biophys. Acta, 1994. 1219(1): p. 201-4
    [PMID:7916213]