PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g07790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family WOX
Protein Properties Length: 312aa    MW: 34366.4 Da    PI: 7.1967
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g07790.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.79.2e-093402457
                     S--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox 24 ypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     +p ++e++++  +l    ++ +++V++WFqNr+ + k+
  Vradi07g07790.1  3 NPPRDEIRKIRVQLqeygQVGDANVFYWFQNRKSRSKN 40
                     7999*******************************995 PP

2Wus_type_Homeobox66.26.2e-221412464
  Wus_type_Homeobox 24 lrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       +++P+++ei++i+ +L+eyG+++d+NVfyWFQNrk+R+++k
    Vradi07g07790.1  1 MVNPPRDEIRKIRVQLQEYGQVGDANVFYWFQNRKSRSKNK 41
                       78*************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000463.4E-6339IPR001356Homeobox domain
SuperFamilySSF466892.29E-5344IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MVNPPRDEIR KIRVQLQEYG QVGDANVFYW FQNRKSRSKN KLRHIQNSKN HNTETQANLL  60
SLSQIIPPST SSSSSDKSSS KELVHPNAIS FGFSNVNDAL PNSPTASVNQ TYLQSHNYNN  120
TALLPPVIES FSFPLHNNGQ GVIVNDTITT HGFSIPQFSN NIMQSQPQCE PKVGHSSSLF  180
LNEIMSHGTF SKKDQDQEKA LKSMHRQQLS SPPTSSSTTT VAHEISTLPC PITQLQGVGG  240
EVTADREKCI VFINDVAFEV MMGPFNVRQA FGDEAVLIHS SGPVPTDDWG ITLHPLQHGA  300
YYYLFSAGLK V*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi07g07790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014506392.10.0WUSCHEL-related homeobox 9-like
RefseqXP_022640191.10.0WUSCHEL-related homeobox 9-like
TrEMBLA0A1S3UK300.0A0A1S3UK30_VIGRR; WUSCHEL-related homeobox 9-like
STRINGXP_007153888.11e-180(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-42homeobox-3