PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g06100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 405aa    MW: 45379.4 Da    PI: 8.4467
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g06100.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.97.9e-53151421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      + pGfrFhPtdeelv +yLk+kv++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++s
  Vradi07g06100.1  15 MLPGFRFHPTDEELVGFYLKRKVQQRPLSI-ELIKQLDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTRAGFWKATGTDRPIYS 107
                      579***************************.89***************8888999*************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +++ +glkk+Lvfykgra kg ktdW+mhe+rl
  Vradi07g06100.1 108 SeGSKCIGLKKSLVFYKGRAAKGIKTDWMMHEFRL 142
                      956677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-5714174IPR003441NAC domain
PROSITE profilePS5100556.88415174IPR003441NAC domain
PfamPF023656.1E-2617142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MEERNDNGEK LDEVMLPGFR FHPTDEELVG FYLKRKVQQR PLSIELIKQL DIYKYDPWDL  60
PKLATTGEKE WYFYCPRDRK YRNSARPNRV TRAGFWKATG TDRPIYSSEG SKCIGLKKSL  120
VFYKGRAAKG IKTDWMMHEF RLPSLTNPSS SPKNFMDKTI PANESWAICR IFKKTNATAQ  180
RALSHSWVSP LPETTTSDHM LATDRYGNQF STENMPLPKK TSLTSQFCTF NNNDSQHSTT  240
TSSSTPCPIE ILASYNKPII NPLMLYKPLD LLPISNGDLG TGLIFSSPIE TSTICAKSSM  300
DVSSLLMSTS TSVLGEFNSK TSEGMCTNFG GLQEHGNGYQ IPLLREMQGS FGNHDDNVLV  360
KIPNVNVPRV GDQQSETVRS IGFPFGIGDA WKSNVLWDTS SLSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-521718119171NO APICAL MERISTEM PROTEIN
1ut4_B2e-521718119171NO APICAL MERISTEM PROTEIN
1ut7_A2e-521718119171NO APICAL MERISTEM PROTEIN
1ut7_B2e-521718119171NO APICAL MERISTEM PROTEIN
4dul_A2e-521718119171NAC domain-containing protein 19
4dul_B2e-521718119171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi07g06100.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022640166.10.0protein FEZ
SwissprotQ9ZVH01e-113FEZ_ARATH; Protein FEZ
TrEMBLA0A3Q0F9990.0A0A3Q0F999_VIGRR; protein FEZ
STRINGXP_007158658.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-111NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]