PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g01070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 337aa    MW: 38810.1 Da    PI: 7.4311
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g01070.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.93.6e-48261491129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      +ppGfrFhPtdeelv +yL+kkv+++k++l + i   d+  +e  ++    ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v++
  Vradi07g01070.1  26 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DSIVVKDLSLAERCRIG---YEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKSVYE 115
                      69****************************.77999999999999996...45789************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +++l+g++ktLvfykgrap+g+ktdW+mheyrle
  Vradi07g01070.1 116 -RTKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 149
                      .999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-5022180IPR003441NAC domain
PROSITE profilePS5100550.04226180IPR003441NAC domain
PfamPF023659.4E-2927148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MCAVKILDKG TTESEVPVID TMESCVPPGF RFHPTDEELV GYYLRKKVAS QKIDLDSIVV  60
KDLSLAERCR IGYEEQNEWY FFSHKDKKYP TGTRTNRATM AGFWKATGRD KSVYERTKLI  120
GMRKTLVFYK GRAPNGQKTD WIMHEYRLET VENGPPQATF QHIIECVQEE GWVVCRAFRK  180
RTNGQTKSIE GWDRRYTYED PIDLMLRKPQ RNNISAENLL YKKETRLMHA EEVMQLPELQ  240
SPSVTIMKKQ SSTSDNINNE KELSKVTDWR ALDKFVASQL SQEDRHEIEG MSSFAGLTGS  300
DIPFLLLQNT NERNKFNPFL TAPSSDCDIG ICVFQT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-432318212170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi07g01070.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-164AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507857.10.0NAC domain-containing protein 37
RefseqXP_014507859.10.0NAC domain-containing protein 37
SwissprotQ9SL411e-119NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A1S3UPD00.0A0A1S3UPD0_VIGRR; NAC domain-containing protein 37
STRINGXP_007156123.11e-177(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45653459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-121vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]