PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g00970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GATA
Protein Properties Length: 235aa    MW: 25853.2 Da    PI: 9.5595
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g00970.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.58.7e-19152186135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  Vradi07g00970.1 152 CSHCGVQKTPQWRTGPLGAKTLCNACGVRYKSGRL 186
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577169.5E-15145208No hitNo description
PROSITE profilePS5011411.939146182IPR000679Zinc finger, GATA-type
SMARTSM004012.1E-16146200IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.4E-15150184IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.30E-13151199No hitNo description
PROSITE patternPS003440152177IPR000679Zinc finger, GATA-type
PfamPF003201.1E-16152186IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MECLEAVLKS SFRKDMALKL SPQAYTEDLN MQNVNSCDDF FVDDLLDFSL LENEEPDQHK  60
HTHHSTSSLA EKPPEPGNAG FTFKTLVPAK PRSKRTRTGV RVWPLRSPSS FTDTSSPRSP  120
LLIFAATSKD HHPEDKRAKK RAASDGGAAR RCSHCGVQKT PQWRTGPLGA KTLCNACGVR  180
YKSGRLLPEY RPACSPTFSS ELHSNHHRKV LEMRQKKEAG PGPDTGSPAS VPGF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156103.11e-127hypothetical protein PHAVU_003G258900g
SwissprotO655154e-51GATA7_ARATH; GATA transcription factor 7
SwissprotQ9FH576e-50GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A0L9TQ001e-133A0A0L9TQ00_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R4171e-133A0A0S3R417_PHAAN; Uncharacterized protein
STRINGGLYMA01G37450.15e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.27e-51GATA transcription factor 5