PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi06g14330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 269aa    MW: 30822.4 Da    PI: 7.0652
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi06g14330.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.28e-20113167256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ ++tkeq  +Lee F+++++++ ++++eLA+kl+L +rqV vWFqNrRa+ k
  Vradi06g14330.1 113 RKKLRLTKEQSAILEENFREHSTLNPKQKQELAMKLNLRTRQVEVWFQNRRARTK 167
                      78889************************************************98 PP

2HD-ZIP_I/II122.52e-39113201189
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                      +kk+rl+keq+++LEe+F+e+++L+p++K+ela +L+l++rqv+vWFqnrRARtk+kq+E+d+++Lk+++d+l+een+rL+keveeL++
  Vradi06g14330.1 113 RKKLRLTKEQSAILEENFREHSTLNPKQKQELAMKLNLRTRQVEVWFQNRRARTKLKQTESDCDVLKKCCDSLTEENKRLQKEVEELKS 201
                      69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.41109169IPR001356Homeobox domain
SuperFamilySSF466891.5E-18110177IPR009057Homeodomain-like
SMARTSM003898.8E-16111173IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.0E-18111174IPR009057Homeodomain-like
CDDcd000862.94E-15112170No hitNo description
PfamPF000462.5E-17113167IPR001356Homeobox domain
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
SMARTSM003403.8E-17169213IPR003106Leucine zipper, homeobox-associated
PfamPF021833.3E-11169202IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MFYIANTTKF SDHLKKLRRV ENPSDCNKTY PSLTLGPPED DDHEELKNDR PSSKTESYEY  60
FRPQVSSPSV VSSFSNSSSI KRERDQAMGE EFDVEVEKVQ TRVADADEDG NPRKKLRLTK  120
EQSAILEENF REHSTLNPKQ KQELAMKLNL RTRQVEVWFQ NRRARTKLKQ TESDCDVLKK  180
CCDSLTEENK RLQKEVEELK SMQAMSVPLY MQIPAATLSL CPSCERICGS KSDDENTNNN  240
TSSLLFPSKT HHFYKSNYPF SHSSSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161169RRARTKLKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi06g14330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-175AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014503808.10.0homeobox-leucine zipper protein HOX15
TrEMBLA0A1S3UCQ70.0A0A1S3UCQ7_VIGRR; homeobox-leucine zipper protein HOX15
STRINGGLYMA14G10370.11e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.17e-61homeobox from Arabidopsis thaliana