PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi06g12540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 240aa    MW: 27282.1 Da    PI: 8.4297
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi06g12540.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-55291561128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL++k+++++++  ++i+ vd++k+ePwdLp k+k ++kewyfF  rd+ky+tg r+nrat++gyWk+tgkdke+l+
  Vradi06g12540.1  29 LPPGFRFHPTDEELICYYLTNKISDSDFTP-KAIAVVDLNKCEPWDLPGKAKMGQKEWYFFNLRDRKYPTGVRTNRATNTGYWKTTGKDKEILN 121
                      79*************************998.88***************999999***************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++elvg+kktLvfykgrap+gekt+Wvmheyr+
  Vradi06g12540.1 122 SvTSELVGMKKTLVFYKGRAPRGEKTNWVMHEYRI 156
                      989999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-5924161IPR003441NAC domain
PROSITE profilePS5100553.71529190IPR003441NAC domain
PfamPF023652.0E-2930156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MQKDKEIVGK EGKDIEMEEG THEKKEETLP PGFRFHPTDE ELICYYLTNK ISDSDFTPKA  60
IAVVDLNKCE PWDLPGKAKM GQKEWYFFNL RDRKYPTGVR TNRATNTGYW KTTGKDKEIL  120
NSVTSELVGM KKTLVFYKGR APRGEKTNWV MHEYRIHSKS TFKITKPLLK PMIAPPQPLS  180
AHTVAQMNHD FSSNMVTPGA ALAADSVVYG SDMTNANSHG NRFMGMDHCM DLDTYWPSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-51201561142NO APICAL MERISTEM PROTEIN
1ut4_B5e-51201561142NO APICAL MERISTEM PROTEIN
1ut7_A5e-51201561142NO APICAL MERISTEM PROTEIN
1ut7_B5e-51201561142NO APICAL MERISTEM PROTEIN
4dul_A5e-51201561142NAC domain-containing protein 19
4dul_B5e-51201561142NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description