PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi06g09750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 279aa    MW: 30321.1 Da    PI: 9.9526
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi06g09750.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM41.25e-131655141
              NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiyk 41
                     lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+y+
  Vradi06g09750.1 16 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-AIIAEVDLYN 55
                     79****************************.88*****996 PP

2NAM81.81.4e-255412261128
              NAM  61 FskrdkkyatgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +rd+ky++g r+nra++sgyWkatg+dk+vl++ ++++vg+kk Lvfy g+ p+g kt+W+mheyrl
  Vradi06g09750.1  54 YNPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSgGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRL 122
                      7899*****************************9977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-4910156IPR003441NAC domain
PROSITE profilePS5100534.68416156IPR003441NAC domain
PfamPF023651.0E-2217122IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MESTDSSTGS QHQPQLPPGF RFHPTDEELV VHYLKKKAAS VPLPVAIIAE VDLYNPRDRK  60
YPNGARPNRA ATSGYWKATG TDKPVLTSGG TQKVGVKKAL VFYGGKPPRG IKTNWIMHEY  120
RLADNKPNNR PPGCDLGNKK NSLRLDDWVL CRIYKKSNTH STTGTTAGGM GASNSKAELP  180
FVPTMTHSSN TCKRTLSSLY WNDEDLAGTS SSNKRLNLES GDNNHGSVVR TDQDNGTATS  240
IVTLLNQLPQ TPSLHQQSML GSIGDGLLRT TYQIPGMN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-56101589170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi06g09750.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020202626.11e-174NAC transcription factor 56
SwissprotQ9LD442e-86NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A151RBC41e-173A0A151RBC4_CAJCA; NAC domain-containing protein 18
STRINGGLYMA13G35560.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.12e-87NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]