PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi06g09740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 229aa    MW: 25387.5 Da    PI: 8.7624
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi06g09740.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM83.25.2e-26309562128
              NAM  62 skrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Vradi06g09740.1  30 HPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 95 
                      689**************************9999.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100530.3271118IPR003441NAC domain
SuperFamilySSF1019413.92E-3710101IPR003441NAC domain
PfamPF023651.0E-141595IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGVPEKDPLA QLSLPPGFRF YPTDEELLVH PRDRKYPNGS RPNRVAGSGY WKATGTDKII  60
TTEGRKVGIK KALVFYVGKA PKGTKTNWIM HEYRLLDSSR KTTGTKAQQE EKVSIHQNLG  120
AGGLVDWANP AVLNSVGEFV SGNNQVVQEQ TQGMVNYGGC NDLYVPTFCH VESTLPQKME  180
EEVQSGVRSQ NNNNPWFVQN EFTQGYQNPV DTCGFKFPVQ AVGFGFRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-5411064153NO APICAL MERISTEM PROTEIN
1ut4_B8e-5411064153NO APICAL MERISTEM PROTEIN
1ut7_A8e-5411064153NO APICAL MERISTEM PROTEIN
1ut7_B8e-5411064153NO APICAL MERISTEM PROTEIN
3swm_A8e-5411187168NAC domain-containing protein 19
3swm_B8e-5411187168NAC domain-containing protein 19
3swm_C8e-5411187168NAC domain-containing protein 19
3swm_D8e-5411187168NAC domain-containing protein 19
3swp_A8e-5411187168NAC domain-containing protein 19
3swp_B8e-5411187168NAC domain-containing protein 19
3swp_C8e-5411187168NAC domain-containing protein 19
3swp_D8e-5411187168NAC domain-containing protein 19
4dul_A8e-5411064153NAC domain-containing protein 19
4dul_B8e-5411064153NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi06g09740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-178AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014505280.11e-83NAC domain-containing protein 72
TrEMBLI1LUX91e-100I1LUX9_SOYBN; Uncharacterized protein
STRINGXP_007149614.13e-67(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4066822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-55NAC family protein