PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi06g07230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 580aa    MW: 64937.9 Da    PI: 5.0014
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi06g07230.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.51.1e-52211471127
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lp GfrF+Ptdeel+++yL+ k++g+  ++  vi+e+d++k+ePwdLp  + v++++ ew+fF+++d+ky++g+r nrat++gyWkatgkd+++
  Vradi06g07230.1  21 LPLGFRFRPTDEELIDYYLRSKINGNGDDV-WVIREIDVCKWEPWDLPdlSVVRNKDPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKI 113
                      699************************999.89**************96447777888************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyr 127
                      +s +++l+g+kktLvfy+grapkg++t+Wvmheyr
  Vradi06g07230.1 114 KS-GSALIGMKKTLVFYTGRAPKGKRTNWVMHEYR 147
                      **.9******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6114171IPR003441NAC domain
PROSITE profilePS5100556.43421171IPR003441NAC domain
PfamPF023658.3E-2822147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0071470Biological Processcellular response to osmotic stress
GO:1900426Biological Processpositive regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MGAVVECYPP PRTAVLSLNT LPLGFRFRPT DEELIDYYLR SKINGNGDDV WVIREIDVCK  60
WEPWDLPDLS VVRNKDPEWF FFCPQDRKYP NGHRLNRATN HGYWKATGKD RKIKSGSALI  120
GMKKTLVFYT GRAPKGKRTN WVMHEYRPTL KELDGTNPGQ NPYVLCRLFK KHDESLEGSN  180
GEDVERTAST PMTANHSPDE IQSDSSLDPA SSSQITEGEK PLTVIHENSE EAISNIITAV  240
DSHSDGCDAP AAQNQIVKPA AEQDQPFNFE DFYDPTNQQL DDKLFSPVHA HFPPEIYYQS  300
ELQYGTNNNM SDFFDSVNWD AISYDTSSLE LGSSFLNVRD NGSGSDSDVE MTNMTFYLLL  360
QNLQALHGYP KEAVEQKSNV GLFQNTPQMA FSNDGCMGQV DDPIKNSGQL RDFDTFVNGD  420
TGIRIRTRPG RNEQPNMNGM VQSQGIAPRR IRLLVDRQFA SEKAPKDGSC ASVPEDHNSK  480
TTISREWNAS ENHATDDSSG SCNDVDEAEK ESPESSDLRK ITRQHIATAE SLISKESRRG  540
HHTSKVLSNR GMWSYVLAVS ATVLVSVTVI VNIWAYVRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-44121747171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00108PBMTransfer from AT4G35580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi06g07230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014505173.10.0protein NTM1-like 9 isoform X1
TrEMBLA0A1S3UGL10.0A0A1S3UGL1_VIGRR; protein NTM1-like 9 isoform X1
STRINGXP_007141360.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.37e-92NAC transcription factor-like 9