PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi06g05940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 557aa    MW: 63278.2 Da    PI: 4.7191
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi06g05940.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM46.61.1e-1410475491
              NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91
                     ++ ewyfFs+rd+ky++g+r+nratksgyWkatgkd++
  Vradi06g05940.1 10 KDLEWYFFSPRDRKYPNGSRTNRATKSGYWKATGKDRK 47
                     5669*******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100515.0951106IPR003441NAC domain
SuperFamilySSF1019416.67E-15846IPR003441NAC domain
PfamPF023653.2E-51449IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MNWKSLLPGK DLEWYFFSPR DRKYPNGSRT NRATKSGYWK ATGKDRKDAY ALCRVLKKTA  60
VIPQKVEGHY VNVPNVNQIT SDQSSSIELY SEGRGEDLVD SSNYFMSVDT CSPHNVGTET  120
PLTISGVTTM DHEKWSHFSS QDSMFSLPTS SYPNFGAIAY PPSKVDIALE CARMQHRFVM  180
PPLEVDDFPQ VGISELKMTQ ASSSMQGSRT ETDILQEILS VAQASQELIN QSNYSQEWCG  240
NDYYAPRDED FAFMVGTNYN HSSEIMNSVR YVDKAWEDAN TRTIEIGDMD EEFKVERNVE  300
NLRWVGMSKE DLEKMEEQNI VPIEDISSFQ TKMKENEVQE SEQHSNMEHN GTEINDFSLG  360
FINDDDPTEN LTEDGNKDDY SSSPSFEVVE EIKVNRGMLV STRQVAETFF QQMVPSQTVQ  420
VQLNTVMAHN HYVENAEAMV LIMEEQGSLR KVKAYVMGKL IKSSMTIASA IVFVFALVIM  480
HYAFIKGEVK FWNETYCSNC DKIMKKTNRS CQIMNESNDV WFIGIKSGKG LNAVLKKIGI  540
FLTIFFVLCA MWANHS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-1466261121NO APICAL MERISTEM PROTEIN
1ut4_B4e-1466261121NO APICAL MERISTEM PROTEIN
1ut7_A4e-1466261121NO APICAL MERISTEM PROTEIN
1ut7_B4e-1466261121NO APICAL MERISTEM PROTEIN
3swm_A5e-1466264124NAC domain-containing protein 19
3swm_B5e-1466264124NAC domain-containing protein 19
3swm_C5e-1466264124NAC domain-containing protein 19
3swm_D5e-1466264124NAC domain-containing protein 19
3swp_A5e-1466264124NAC domain-containing protein 19
3swp_B5e-1466264124NAC domain-containing protein 19
3swp_C5e-1466264124NAC domain-containing protein 19
3swp_D5e-1466264124NAC domain-containing protein 19
4dul_A4e-1466261121NAC domain-containing protein 19
4dul_B4e-1466261121NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi06g05940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014503656.10.0NAC domain-containing protein 86
TrEMBLA0A1S3UCA40.0A0A1S3UCA4_VIGRR; NAC domain-containing protein 86
STRINGXP_007141968.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.16e-82NAC domain containing protein 28