PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi06g05780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 416aa    MW: 45098.2 Da    PI: 8.3983
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi06g05780.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.93.9e-32272325255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Vradi06g05780.1 272 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 325
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15269325IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28270325IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23272325IPR006447Myb domain, plants
PfamPF002497.4E-7273324IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MTLEGIFIEP TSTTAPDLSL HISPPSISSS LISNTNNIAN YEPQPSFLSR TVSQAHTELS  60
LGRNFTSARE TPPPTPTPTP HNPYYPTQTH FHHLLHSSTS SSTTTSSNIP TSLPTSANTP  120
LNHINYGVSL LDVSSSDGLR PIKGIPVYHN RSFPFVAMDH ARDNKDPHTK MCLYHHMPSY  180
PSLSSSCSSL CSTTAPSSSP SPYFVDPMSF LNNASTVGCR TATATRFNGF SGDAFKSHPL  240
HQYGVGSSEA SSGFMRSRFL SKLPNKRSMR APRMRWTSTL HARFVHAVEL LGGHERATPK  300
SVLELMDVKD LTLAHVKSHL QMYRTVKTTD KPAASSGHSD GSGEDDLSPI GSTADRGNGL  360
RSPILQSQTI SGAHQIQECD STQQKNNMGG SNLECKNPSL EFTLGRPHWD GKEQA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-17273327458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-17273327458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-17273327458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-17273327458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-17273327458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-17273327458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-17273327458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-17273327458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi06g05780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502849.10.0transcription repressor KAN1
TrEMBLA0A1S3UA620.0A0A1S3UA62_VIGRR; transcription repressor KAN1
STRINGGLYMA14G39260.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.19e-52G2-like family protein