PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi06g01720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 84aa    MW: 9430.85 Da    PI: 9.2734
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi06g01720.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26084.71.3e-26674169
           DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69
                     +CaaCk +rr+C++dC+++pyfpa++p++fa vhk++G snv k+l+++p+  re+++++l++eA+  +
  Vradi06g01720.1  6 RCAACKNQRRRCPSDCIFSPYFPANDPQRFASVHKIYGGSNVGKMLQQIPPYLREQTANCLYFEAQYYM 74
                     6****************************************************************9866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.475583IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-26675IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MMISGRCAAC KNQRRRCPSD CIFSPYFPAN DPQRFASVHK IYGGSNVGKM LQQIPPYLRE  60
QTANCLYFEA QYYMSQASTP APK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-217711276LOB family transfactor Ramosa2.1
5ly0_B1e-217711276LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi06g01720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-76AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502924.23e-47LOB domain-containing protein 24-like
SwissprotP594671e-26LBD23_ARATH; LOB domain-containing protein 23
TrEMBLA0A1S3UAD06e-46A0A1S3UAD0_VIGRR; LOB domain-containing protein 24-like
STRINGXP_007142295.11e-44(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.16e-29LOB domain-containing protein 23