![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi06g01720.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 84aa MW: 9430.85 Da PI: 9.2734 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 84.7 | 1.3e-26 | 6 | 74 | 1 | 69 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69 +CaaCk +rr+C++dC+++pyfpa++p++fa vhk++G snv k+l+++p+ re+++++l++eA+ + Vradi06g01720.1 6 RCAACKNQRRRCPSDCIFSPYFPANDPQRFASVHKIYGGSNVGKMLQQIPPYLREQTANCLYFEAQYYM 74 6****************************************************************9866 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 18.475 | 5 | 83 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.6E-26 | 6 | 75 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MMISGRCAAC KNQRRRCPSD CIFSPYFPAN DPQRFASVHK IYGGSNVGKM LQQIPPYLRE 60 QTANCLYFEA QYYMSQASTP APK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-21 | 7 | 71 | 12 | 76 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-21 | 7 | 71 | 12 | 76 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi06g01720.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015036 | 1e-76 | AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014502924.2 | 3e-47 | LOB domain-containing protein 24-like | ||||
Swissprot | P59467 | 1e-26 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
TrEMBL | A0A1S3UAD0 | 6e-46 | A0A1S3UAD0_VIGRR; LOB domain-containing protein 24-like | ||||
STRING | XP_007142295.1 | 1e-44 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3697 | 30 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26620.1 | 6e-29 | LOB domain-containing protein 23 |