PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g19600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 470aa    MW: 52334.1 Da    PI: 6.5125
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g19600.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.6e-51111341128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhP+deelv++yL kkv++++  l   + +vd++k+ePwd+p ++  + kewyf+++rd+kyatg r+nrat+sgyWkatgkd+++l+
  Vradi05g19600.1  11 LPPGFRFHPRDEELVCDYLMKKVTHNDSLL---MIDVDLNKCEPWDIPDTACVGGKEWYFYTQRDRKYATGLRTNRATASGYWKATGKDRPILR 101
                      79***********************99544...789************7666789**************************************9 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       kg+lvg++ktLvfy+grapkg+kt+Wvmhe+r+
  Vradi05g19600.1 102 -KGTLVGMRKTLVFYQGRAPKGRKTEWVMHEFRI 134
                      .999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-602159IPR003441NAC domain
PROSITE profilePS5100556.41611158IPR003441NAC domain
PfamPF023654.3E-2712134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MSNISMVEAK LPPGFRFHPR DEELVCDYLM KKVTHNDSLL MIDVDLNKCE PWDIPDTACV  60
GGKEWYFYTQ RDRKYATGLR TNRATASGYW KATGKDRPIL RKGTLVGMRK TLVFYQGRAP  120
KGRKTEWVMH EFRIEGPHGP PKVSSSKEDW VLCRVFYKNR EVSAKPSIGS CYEDTGSSSL  180
PALMDSYISF DQTQAHADEF EQVPCFSIFS QNQANPIFNH MTTMEPKLPA AAYGGAPNLG  240
YCLDPLSCDR KVLKAVLSQI TKMERNPLNQ NLKGSPSFGE GSSESYLSEG VSVGYKYRIQ  300
GKGRPKVCVD EASSSSSTVG SSILGTTERK EDLGDEATNV NRNNFVPQSV EEMVVETKID  360
ATNEWDGSCE PLSPVPGYDW TPHEATLKEN EVLVAQVVDA INAHKGCDQA CKKLAAKMED  420
ACKAVQQLQR EVDDLKLENQ TLTQRQTELN QEKVNLPKQK NDLVVGSKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-48615912166NO APICAL MERISTEM PROTEIN
1ut4_B4e-48615912166NO APICAL MERISTEM PROTEIN
1ut7_A4e-48615912166NO APICAL MERISTEM PROTEIN
1ut7_B4e-48615912166NO APICAL MERISTEM PROTEIN
3swm_A5e-48615915169NAC domain-containing protein 19
3swm_B5e-48615915169NAC domain-containing protein 19
3swm_C5e-48615915169NAC domain-containing protein 19
3swm_D5e-48615915169NAC domain-containing protein 19
3swp_A5e-48615915169NAC domain-containing protein 19
3swp_B5e-48615915169NAC domain-containing protein 19
3swp_C5e-48615915169NAC domain-containing protein 19
3swp_D5e-48615915169NAC domain-containing protein 19
4dul_A4e-48615912166NAC domain-containing protein 19
4dul_B4e-48615912166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi05g19600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4026020.0AF402602.1 Phaseolus vulgaris NAC domain protein NAC1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502180.10.0NAC domain-containing protein 21/22
SwissprotQ84TE61e-119NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A1S3U8240.0A0A1S3U824_VIGRR; NAC domain-containing protein 21/22
STRINGXP_007149262.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100103241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-116NAC domain containing protein 1
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]