PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g18650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 341aa    MW: 39176.2 Da    PI: 4.7211
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g18650.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-5241266128
              NAM   6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                       FhPtdeelv +yL++k++g+++el ++i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd++v+s ++
  Vradi05g18650.1   4 MFHPTDEELVAYYLERKITGRSIEL-DIIAEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATQAGYWKATGKDRPVHS-QK 95 
                      6************************.99**************96435566888**************************************.99 PP

              NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                      + vg+kktLv+y+grap+g +t+Wvmheyrl
  Vradi05g18650.1  96 KPVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 126
                      9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.4441150IPR003441NAC domain
PfamPF023656.7E-263126IPR003441NAC domain
SuperFamilySSF1019418.89E-594150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MYVMFHPTDE ELVAYYLERK ITGRSIELDI IAEVDLYKCE PWDLPDKSFL PSKDMEWYFY  60
SPRDRKYPNG SRTNRATQAG YWKATGKDRP VHSQKKPVGM KKTLVYYRGR APHGIRTNWV  120
MHEYRLIESL PGAALSSLKD SYSLCRIFKK MIQMPAKPSK EEEQQAEDAK KESMWISEEQ  180
MLGEDSSGTE FSREMETVEE KILNHEYPKF PCDASSSDLT QGTCTPTDTG IAEDFQPHFA  240
CDEANSATNS YTMGMGYPSN LFQDVEIPSF AAMHYQFPYT PLVLEDFPQI TLPETKSTKP  300
EMSDSCMLYD RHRDCMNGTL EEIISLCCTQ DNNVPFPMLE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-52515023165NO APICAL MERISTEM PROTEIN
1ut4_B1e-52515023165NO APICAL MERISTEM PROTEIN
1ut7_A1e-52515023165NO APICAL MERISTEM PROTEIN
1ut7_B1e-52515023165NO APICAL MERISTEM PROTEIN
3swm_A2e-52515026168NAC domain-containing protein 19
3swm_B2e-52515026168NAC domain-containing protein 19
3swm_C2e-52515026168NAC domain-containing protein 19
3swm_D2e-52515026168NAC domain-containing protein 19
3swp_A2e-52515026168NAC domain-containing protein 19
3swp_B2e-52515026168NAC domain-containing protein 19
3swp_C2e-52515026168NAC domain-containing protein 19
3swp_D2e-52515026168NAC domain-containing protein 19
4dul_A1e-52515023165NAC domain-containing protein 19
4dul_B1e-52515023165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi05g18650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014500624.10.0NAC domain-containing protein 71 isoform X2
TrEMBLA0A1S3U3Q20.0A0A1S3U3Q2_VIGRR; NAC domain-containing protein 71 isoform X2
STRINGXP_007149170.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-91NAC domain containing protein 20