PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g18500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 281aa    MW: 31910.8 Da    PI: 7.8939
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g18500.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM109.44.2e-34209454128
              NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++++++ +g++ktLvfy+grap+g+ktdW+mheyrl
  Vradi05g18500.1  20 PQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIYHTNSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 94 
                      457**********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.051115IPR003441NAC domain
SuperFamilySSF1019416.54E-3819115IPR003441NAC domain
PfamPF023653.8E-162094IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MMPSNGQLTV PPGFRIGSGP QNEWYFFSHK DKKYPTGTRT NRATTAGFWK ATGRDKAIYH  60
TNSKRIGMRK TLVFYTGRAP HGQKTDWIMH EYRLDEDDAD VQQEDGWVVC RVFKKKNQNR  120
GFQQEIEEEE NLTHMRTSGP CHVLEPKHHM QGGLYDYNFD GTMQLPQLFS PESAVAPNNS  180
CLATSMNAMD ILECSQNLLR LTTNGCGLNL MQQQGERFSG DWSFLDKLLA SHHAMDHQHH  240
PQSKCNPPTH QAATSVATSA QKFPFHYLGC DTHDIMKFSK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-322111770167NO APICAL MERISTEM PROTEIN
1ut4_B7e-322111770167NO APICAL MERISTEM PROTEIN
1ut7_A7e-322111770167NO APICAL MERISTEM PROTEIN
1ut7_B7e-322111770167NO APICAL MERISTEM PROTEIN
4dul_A7e-322111770167NAC domain-containing protein 19
4dul_B7e-322111770167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi05g18500.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022637031.10.0NAC domain-containing protein 76 isoform X1
SwissprotQ9MA173e-73SMB_ARATH; Protein SOMBRERO
TrEMBLA0A3Q0F0P60.0A0A3Q0F0P6_VIGRR; NAC domain-containing protein 76 isoform X1
STRINGXP_007149140.11e-180(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-65NAC family protein
Publications ? help Back to Top
  1. Fendrych M, et al.
    Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis.
    Curr. Biol., 2014. 24(9): p. 931-40
    [PMID:24726156]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  3. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  4. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]