PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g18150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 245aa    MW: 27346.5 Da    PI: 9.8077
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g18150.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.9e-1865119256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Vradi05g18150.1  65 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 119
                      678899***********************************************98 PP

2HD-ZIP_I/II129.31.6e-4165155192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  Vradi05g18150.1  65 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 155
                      69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-1848115IPR009057Homeodomain-like
SuperFamilySSF466893.94E-1951122IPR009057Homeodomain-like
PROSITE profilePS5007117.02261121IPR001356Homeobox domain
SMARTSM003891.1E-1563125IPR001356Homeobox domain
PfamPF000469.8E-1665119IPR001356Homeobox domain
CDDcd000861.15E-1565122No hitNo description
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
SMARTSM003401.6E-25121164IPR003106Leucine zipper, homeobox-associated
PfamPF021833.4E-11121155IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MELGLSLGDS SRPLLSFMEK PREASNQLGG GSFYKRNYEG EAYDQRASSR ASDEDDNNGS  60
GGNGRKKLRL SKEQSAFLEE SFKEHNTLNP KQKLALAKQL NLRPRQVEVW FQNRRARTKL  120
KQTEVDCEYL KRCCETLTEE NRRLHKELQE LRALKSSNPF YMQLPATTLT MCPSCERVAT  180
NSTSTSSSQS APNATINANS GAMTIVKSSA TNNDSPSKPI GFPFGKPRFH PFVHTTHQHQ  240
SPSS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi05g18150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014500099.11e-158homeobox-leucine zipper protein HOX11
SwissprotA2YW033e-79HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
SwissprotP466651e-79HAT14_ARATH; Homeobox-leucine zipper protein HAT14
SwissprotQ6YPD03e-79HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLA0A1S3U2821e-157A0A1S3U282_VIGRR; homeobox-leucine zipper protein HOX11
STRINGXP_007149086.11e-140(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-60homeobox from Arabidopsis thaliana