PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g15890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 500aa    MW: 56034.4 Da    PI: 7.6529
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g15890.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.27.8e-29295346152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Vradi05g15890.1 295 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 346
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.291285366IPR003035RWP-RK domain
PfamPF020422.1E-24299346IPR003035RWP-RK domain
SMARTSM006661.1E-21400483IPR000270PB1 domain
PROSITE profilePS5174522.891400483IPR000270PB1 domain
CDDcd064072.26E-39403482No hitNo description
PfamPF005642.4E-16403482IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.3E-21403481No hitNo description
SuperFamilySSF542772.07E-21403485No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MVIQVWVPAR RGCEVGIHHH QDFPYTLDYI SNGDATRSFQ FHEEWLSDHW PPNIRFLRTH  60
DYPRLHHYDL RPGSLAIPVF QRGTGICLAS FVADVDVLGF LEACSEYHLL GGQGVVGTAF  120
TTSKPCFAND ITAFTKAEYP LAHHANMFGL HAAVAIPLRS VSSDFVLEFF LPKDCHDTQD  180
QKQILNSLSM LVQQACRSLH VVLDKEEEEE LVSHHHHHHS KEMESSSWIA HMMEAQQKGK  240
GVSVSLEYLQ EPKQEFKVTT NCNEQVFSDL EGTGGAGVGG RRGGRKSGDK RRTKAEKTIS  300
LPVLRQYFAG SLKDAAKSIG VCPTTLKRIC RQHGITRWPS RKIKKVGHSL RKLQLVIDSV  360
QGAEGAIQIG SFYTSFPELS ANGVSESPKI NSDNSKFYSE NGVKATFGDE KIRFSLQPNC  420
GFRDLQMEIA RRFNLKEMSK IQVKYLDDAQ EWVLLTCDAD LEECKDINRS SQSRTVRLFL  480
FHASPLNHST NAFGSTSPT*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi05g15890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017420520.10.0PREDICTED: protein NLP1
SwissprotQ7X9B91e-100NLP2_ARATH; Protein NLP2
SwissprotQ9SFW81e-100NLP5_ARATH; Protein NLP5
TrEMBLA0A0L9UIJ90.0A0A0L9UIJ9_PHAAN; Uncharacterized protein
STRINGXP_007137300.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.17e-87Nin-like family protein