PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g15090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GATA
Protein Properties Length: 313aa    MW: 34743.9 Da    PI: 7.0526
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g15090.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.92.8e-18217250134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  Vradi05g15090.1 217 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 250
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.71E-13211272No hitNo description
SMARTSM004011.7E-12211265IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.411211247IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.6E-14215248IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.36E-13216273No hitNo description
PfamPF003203.8E-16217250IPR000679Zinc finger, GATA-type
PROSITE patternPS003440217242IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MEVAVAKALK PSLRREFIVQ QTHCEDFFSL NANTVAGGDD FFVDDLFDFS DGSLHYEPQE  60
YVEEKKSLSA SSQSKDRGED DSNSNSTGVS YDSLFSAELA VPAGDLEDLE WVSHFVDDSL  120
PELSLLYPVR SEEVNRRVEP EPSAKKTPRF PCETKITTKT RTVRNRKPNA RVWSLGPLLS  180
LPSSPSSCSS SSTEPPAKKQ KKRAEAQPVG AQVQRRCSHC QVQKTPQWRT GPLGAKTLCN  240
ACGVRYKSGR LFSEYRPACS PTFCSDIHSN SHRKLVVGQG AMNFQQPFNL YDISTYQVDT  300
TQITLTFTPL IT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502491.10.0PREDICTED: GATA transcription factor 7-like
RefseqXP_014502492.10.0PREDICTED: GATA transcription factor 7-like
TrEMBLA0A0L9UIA50.0A0A0L9UIA5_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RA080.0A0A0S3RA08_PHAAN; Uncharacterized protein
STRINGGLYMA06G01110.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-44GATA transcription factor 7