PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g14430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 873aa    MW: 97246.5 Da    PI: 5.651
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g14430.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.9e-29557607252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Vradi05g14430.1 557 EKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 607
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.401.1E-4162261IPR029016GAF domain-like
PROSITE profilePS5151917.814544627IPR003035RWP-RK domain
PfamPF020426.1E-25559607IPR003035RWP-RK domain
SuperFamilySSF542771.91E-23777863No hitNo description
SMARTSM006662.6E-25778861IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.0E-23778858No hitNo description
PROSITE profilePS5174526.92778861IPR000270PB1 domain
CDDcd064071.26E-42779859No hitNo description
PfamPF005643.5E-20779859IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 873 aa     Download sequence    Send to blast
MMRDGGVTSS SASMTEAPPP DGTITTKTMD FDYMGELFLD GCWLEASVDG SDFLPQSPSF  60
SNPLFDPSFS WPALETNHNE SQGAAFGTQQ EGHNNNMVNV VVGCGDGGGQ ENKNMLIQIW  120
VPVHRGGRPI LAANDILFSL DSRSVNLAKY REISVRYEFS AEEGEVKELV PAEKGGSKEL  180
LLGLPGRVFR DKVPEWTPDV RFFRSDEYPR VDHAQEYDVR GSLAVPIFEQ GSKMCLGVIE  240
VVMTTQQINY TPELESVCKA LEAVDLRSSK QLNIHNVKAC NRSYEAVLPE IQLVLRSACE  300
MHRLPLAQTW IPCVQQGKEG CRHSEDNYLL CISPVEHACY VGDPKIRPFH ESCTEHHLLK  360
GEGVAGGAFI TNQPCFSDDI TSLSKKDYPL SHHARLFGLR AAVAIRLRSI LNDTDDFVLE  420
FFLPVDCSDS EEQRKMLTSL SIIIQRLCRS LRVISDKELE EANSSIDEMI FLADGGFDRT  480
VICEELQHKG TVALWNTEEK LSETTGRKFS DPRQQQQESL NFKGNLDCVR ECSTSVQGNL  540
SSVGMSKMGE RRRAKGEKTI TLQVLRQYFA GSLKDAAKNI GVCTTTLKRI CRQHGIKRWP  600
SRKIKKVGHS LQKLQLVIDS VQGASGAFQI DSFYSNFPEL ASPNLSGTSM FSTPNQTDNP  660
NSISTQPDPG SLSPEGTSKS PSSSCGQSSI SSHSCFSMSE LRQQHHTTDI SGNKDSTMAG  720
EDSLDVALKR IRSEAELKSL NQDKAELLPR SLSQETLGEH PKNQYERPLL KTSSKVDAHR  780
VKVTYGDEKT RFRMPKNWGY EDLMQEIGRR FNVSEMSKFD VKYLDDDSEW VLLTCDADLE  840
ECIDVCRSSE NATIKLSLQI SSHSLRSSLE FR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi05g14430.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502050.10.0protein NLP4 isoform X1
TrEMBLA0A1S3U7P40.0A0A1S3U7P4_VIGRR; protein NLP4 isoform X1
STRINGXP_007136019.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein