PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g00640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 297aa    MW: 32610.8 Da    PI: 5.1572
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g00640.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like39.51.3e-121271542552
          G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQk 52 
                       +A+Pk+ilelm+v+gLt+e+v+SHLQk
  Vradi05g00640.1 127 SEAVPKKILELMNVPGLTRENVASHLQK 154
                      68*************************9 PP

2Response_reg28.67e-115510855109
                      TSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
     Response_reg  55 gmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                      +mdG++ll++i  e  +lp+i+++a + ++ + + +  Ga d+l Kp+ +e+l +
  Vradi05g00640.1  55 DMDGFKLLEHIGLEM-DLPVIMMSADDGKSVVMKGVTHGACDYLIKPVRIEALKN 108
                      7**********6654.8**********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011017.2621114IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.8E-42353No hitNo description
SuperFamilySSF521721.99E-1928118IPR011006CheY-like superfamily
SMARTSM004480.003529110IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.25E-1232114No hitNo description
Gene3DG3DSA:3.40.50.23009.7E-1955130No hitNo description
PfamPF000721.6E-755108IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF466891.38E-5126155IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-11127154IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.5E-11131154IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MNLGSGKGST SSSPLKTGDV VSDKFPAGLR VMVVDDDPTC LRILERMLRA CLYEDMDGFK  60
LLEHIGLEMD LPVIMMSADD GKSVVMKGVT HGACDYLIKP VRIEALKNIW QHVIRKRKNG  120
LKDAEQSEAV PKKILELMNV PGLTRENVAS HLQKSHDWDL TSTGITYDSS QHANPLQGNI  180
DVSPSVLVHQ GFPCLQQQSV QTRDSNSIGK PLFCTGEAIH QSNLQNVSQH LNNLVDSSVR  240
VKAETFPDPS SQINNLFSDQ YGQEDLVTAF LKQQEGVGPS DHDLDFDGYS LDNIPV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi05g00640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014499068.15e-97two-component response regulator ARR2
TrEMBLA0A1S3TZ771e-95A0A1S3TZ77_VIGRR; Two-component response regulator
STRINGXP_007138963.11e-80(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.15e-52response regulator 1