PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0553s00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 980aa    MW: 108365 Da    PI: 6.1445
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0553s00010.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.62.8e-29601651252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Vradi0553s00010.1 601 EKNVSLSVLQQYFSGSLKDAAKNIGVCPTTLKRICRQHGISRWPSRKINKV 651
                        89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.881585671IPR003035RWP-RK domain
PfamPF020424.5E-26603651IPR003035RWP-RK domain
SuperFamilySSF542771.18E-20874963No hitNo description
Gene3DG3DSA:3.10.20.2402.1E-21876958No hitNo description
PROSITE profilePS5174518.78879961IPR000270PB1 domain
SMARTSM006662.5E-19879961IPR000270PB1 domain
CDDcd064071.00E-30880960No hitNo description
PfamPF005644.3E-15882960IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 980 aa     Download sequence    Send to blast
MEYPFSSKER EIGDWQSFGN QLVGSTSLDS RMSNSISEDM PNSFSELMNF DTYAGLCTSP  60
SISDQILANE LPSFASLPYS LPDGFNLVQQ NNGQCYMSGV GRNDNDMESS PIYGEKVACQ  120
QVDTLLGFLN DANEANNLNS KLKIIGSSQH LNNSDAGNYI MSRPPALSLD ERMLRALSFF  180
KESAGGGILA QVWVPIKNGD QFILSTSEQP YLLDQMLAGY REVSRTFTFP AEGKSGCFLG  240
LPGRVFTSKV HEWTSDVGYY SMNEYLRFEH AINHHVRGSI AFPIFEMHSE LLCCAVLEIV  300
TTKEKPDFNR EFEIVCRALQ LVNLSTAKPL RCLPQCLSNN KKATLTEIVD VLRSVCHAHR  360
LPLALTWLPC CYTEGSRGEV TRIRTKGCHS TISGKNILCL EESACYITDR ALAGFVRACT  420
EHHIEEGKGI AGKALRSNHP FFCPDVKAYD ISEYPLVHHA RKYNLNAAVA IRLRSTYTNH  480
DDYILEFFLP VNMRGGLEQQ LLLDNLSGTM QRICSSLRTV SDAELSRIDS SQQGFEMKNA  540
PYFPPLSCQN SGVPLINGDY HSVPMMPSTP TNAGGNEIEP SANQGRNGAK RQVQKNRSTS  600
EKNVSLSVLQ QYFSGSLKDA AKNIGVCPTT LKRICRQHGI SRWPSRKINK VNRSLKKIQT  660
VLDSVRGVEG GLKFDPSMGA FVARGSIIQE TDAHKSLLFP EKNIIKDPAH ITQEAVPVPR  720
APCNEVENFS FKLEEELKKT NSFSVGCCED SKSMAIDDGS CEMESLCTKL QDCPEQACLG  780
SVLPKEQEKW TRNKSGLRVE NFKCSILGQS SNSLIGKEMD IGVDGDAEVV EPNHPSSSSL  840
TDSSNDSGSM MHSISSGSES FKNHNQSKVK STIVDSGSKL IVKAIYREDT IRFKFDRSAG  900
CFRLYEEVAA RFKLQTGSFQ LKYLDDEEEW VMLVSDADLQ ECLDILDDIG TCSVRFLVRD  960
LPSILTSSGS SNSYLGGSS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi0553s00010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490160.10.0protein NLP8
RefseqXP_014490162.10.0protein NLP8
RefseqXP_014490163.10.0protein NLP8
RefseqXP_022633030.10.0protein NLP8
RefseqXP_022633031.10.0protein NLP8
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A1S3T8R90.0A0A1S3T8R9_VIGRR; protein NLP8
STRINGXP_007150469.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]