PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi04g11240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 242aa    MW: 26079.1 Da    PI: 5.4334
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi04g11240.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26038.14.4e-126485799
           DUF260 57 amsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                     +++sl+yeA+ r+ +P+yG+vg+++++++ql+q+++e +l ++
  Vradi04g11240.1  6 IFRSLLYEACGRIVNPIYGSVGLLWSGSWQLCQAAVENVLKGA 48
                     799********************************99988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031953.3E-7643IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MVCLSIFRSL LYEACGRIVN PIYGSVGLLW SGSWQLCQAA VENVLKGAPI TPITSEAAAS  60
GRGPPLKAYD IRHVSRDENS AASNETQQQR VKTRSRVRRP VANAKPKSTT NENNGEKGTE  120
LGSSEPGLMT CEWTEEAVNR SGSHESSLSH QSEAANAVES ESMVSVETAE TSILFRDEPD  180
SNPKIVQRTD DVGLELTLGF EPVSRAQHVV PVKKRRIELK DFSGSAESGS CKMELGLECS  240
A*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi04g11240.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497220.11e-172LOB domain-containing protein 41
TrEMBLA0A1S3TTZ01e-170A0A1S3TTZ0_VIGRR; LOB domain-containing protein 41
STRINGXP_007139150.11e-158(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15463499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.11e-51LOB domain-containing protein 41