PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi04g08910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 347aa    MW: 39140.1 Da    PI: 5.826
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi04g08910.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.6e-53171422129
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      p GfrFhPtdeel+++yL kkv+++ + +  +i+evd++k+ePw+Lp+ +k +e+ewy+Fs rdkky+tg r+nrat++gyWkatgkdke+++ 
  Vradi04g08910.1  17 PTGFRFHPTDEELIKDYLIKKVADNCFCA-VAIAEVDLNKCEPWNLPALAKMGETEWYYFSVRDKKYPTGLRANRATEAGYWKATGKDKEIIA- 108
                      89***********************9887.67***************8888899***************************************. PP

              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +++l+g kktLvfykgrap+gekt+Wvmheyrle
  Vradi04g08910.1 109 ENALIGRKKTLVFYKGRAPRGEKTNWVMHEYRLE 142
                      999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6013163IPR003441NAC domain
PROSITE profilePS5100556.61416163IPR003441NAC domain
PfamPF023651.8E-2617141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MENVYKPSKE NQKFNFPTGF RFHPTDEELI KDYLIKKVAD NCFCAVAIAE VDLNKCEPWN  60
LPALAKMGET EWYYFSVRDK KYPTGLRANR ATEAGYWKAT GKDKEIIAEN ALIGRKKTLV  120
FYKGRAPRGE KTNWVMHEYR LEGKQNQYQY AKGEWVVCRV FEKGPSGRKL NVRRLNSSGN  180
ESSSPSSLLP PLMDSSPNNS EARTTAGQLS QVTSRDPNYT VDQKNTHDGI VEIMETPILN  240
LSSSATPFAV YPFGKPTLSV PDQPAQIANQ IGNSQYPDYC YMPQEQSLKM LMTGNHEPNA  300
KQIQKTEFSD GRDFDADIDT MLENQEIDQL VQGMWTPIAC GITEEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-511316914171NO APICAL MERISTEM PROTEIN
1ut4_B2e-511316914171NO APICAL MERISTEM PROTEIN
1ut7_A2e-511316914171NO APICAL MERISTEM PROTEIN
1ut7_B2e-511316914171NO APICAL MERISTEM PROTEIN
3swm_A2e-511316917174NAC domain-containing protein 19
3swm_B2e-511316917174NAC domain-containing protein 19
3swm_C2e-511316917174NAC domain-containing protein 19
3swm_D2e-511316917174NAC domain-containing protein 19
3swp_A2e-511316917174NAC domain-containing protein 19
3swp_B2e-511316917174NAC domain-containing protein 19
3swp_C2e-511316917174NAC domain-containing protein 19
3swp_D2e-511316917174NAC domain-containing protein 19
4dul_A2e-511316914171NAC domain-containing protein 19
4dul_B2e-511316914171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi04g08910.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497505.10.0NAC domain-containing protein 92
RefseqXP_022635265.10.0NAC domain-containing protein 92
RefseqXP_022635266.10.0NAC domain-containing protein 92
SwissprotQ9FLJ27e-85NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A1S3TUT00.0A0A1S3TUT0_VIGRR; NAC domain-containing protein 92
STRINGXP_007139532.11e-179(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.16e-81NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]