PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi04g08780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 385aa    MW: 43005.2 Da    PI: 9.4236
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi04g08780.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM95.48.7e-3037655129
              NAM  55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      e+ewy+F+ rdkky  g r+nr+t++gyWkatgk +e+++ +++l+glkktLvfykgrap+g+kt+W+mheyrle
  Vradi04g08780.1   3 ETEWYYFCMRDKKYLIGLRANRTTEAGYWKATGKYREIIA-ENALIGLKKTLVFYKGRAPRGKKTNWFMHEYRLE 76 
                      78**************************************.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100537.187197IPR003441NAC domain
SuperFamilySSF1019417.85E-32297IPR003441NAC domain
PfamPF023651.7E-13675IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MGETEWYYFC MRDKKYLIGL RANRTTEAGY WKATGKYREI IAENALIGLK KTLVFYKGRA  60
PRGKKTNWFM HEYRLEGKQN QYQYAKGEWV VRRVFEKGPS GRKLNVRSFK NEEESSKNDS  120
AIGNNADNDV TNDKTSALQC MPPNSSGKGL PYAPEGWPNA GDVWRWRVGA RTSKAGHFTD  180
RFLIALASLR NDSRNLEFSS MKDGDTGSLR KAKRKKESSG GPYKKRKADR VPVGSIPVPV  240
GSVDLVPVGS LDPVPVGSLD PIPVCSVPLA NFDSYLENLE EMLTETIEDH PIESIASCKE  300
KLSSLLALDF PLLVSNNDIG EIAILAWRIL QDPNLTDEQQ LKLKLVEEIP LTGKVFLEAK  360
RSIEEGDKLM VELVGKKVKI SSLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-24110368171NO APICAL MERISTEM PROTEIN
1ut4_B1e-24110368171NO APICAL MERISTEM PROTEIN
1ut7_A1e-24110368171NO APICAL MERISTEM PROTEIN
1ut7_B1e-24110368171NO APICAL MERISTEM PROTEIN
3swm_A1e-24110371174NAC domain-containing protein 19
3swm_B1e-24110371174NAC domain-containing protein 19
3swm_C1e-24110371174NAC domain-containing protein 19
3swm_D1e-24110371174NAC domain-containing protein 19
3swp_A1e-24110371174NAC domain-containing protein 19
3swp_B1e-24110371174NAC domain-containing protein 19
3swp_C1e-24110371174NAC domain-containing protein 19
3swp_D1e-24110371174NAC domain-containing protein 19
4dul_A1e-24110368171NAC domain-containing protein 19
4dul_B1e-24110368171NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209216RKAKRKKE
2212226KRKKESSGGPYKKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi04g08780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-116AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017413572.13e-94PREDICTED: uncharacterized protein LOC108325080 isoform X2
TrEMBLA0A0L9TVG31e-92A0A0L9TVG3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3STP71e-92A0A0S3STP7_PHAAN; Uncharacterized protein
STRINGXP_007145423.18e-71(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.15e-45NAC domain containing protein 100