PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi04g07050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 174aa    MW: 19913.8 Da    PI: 10.6922
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi04g07050.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.29e-143781147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT  E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Vradi04g07050.1 37 RENWTDHEHDKFLEALHLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 81
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.87E-163187IPR009057Homeodomain-like
PROSITE profilePS5129413.9263286IPR017930Myb domain
TIGRFAMsTIGR015573.3E-173584IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-63587IPR009057Homeodomain-like
SMARTSM007171.3E-103684IPR001005SANT/Myb domain
PfamPF002499.7E-113781IPR001005SANT/Myb domain
CDDcd001671.14E-83982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MVSLNSNPPQ TFPFFDPFNM EDPNKKVRKP YTITKSRENW TDHEHDKFLE ALHLFDRDWK  60
KIEAFVGSKT VIQIRSHAQK YFMKVQKNGT SEHVPPPRPK RKAAHPYPQK ASKNALTISK  120
FTRPLQSSSA LSESSFIYRP DSSSVLRTAV SSVPLPSWGY NLTTQVGLLP KVTK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi04g07050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150372e-76AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497263.11e-126protein REVEILLE 3 isoform X1
SwissprotQ6R0H06e-61RVE3_ARATH; Protein REVEILLE 3
TrEMBLA0A1S3TU031e-124A0A1S3TU03_VIGRR; protein REVEILLE 3 isoform X1
STRINGXP_007139791.11e-108(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.22e-46MYB_related family protein
Publications ? help Back to Top
  1. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]
  4. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]