PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi04g02170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family WOX
Protein Properties Length: 196aa    MW: 22083 Da    PI: 10.4498
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi04g02170.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-191877357
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     +R+++t+eq+  Le+l+++  r+p+ae+++e +++l    +++ ++V++WFqN++a++++
  Vradi04g02170.1 18 SRWSPTREQIAMLEDLYRQgMRTPNAEQIQEVTSRLraygHIQGKNVFYWFQNHKARQRQ 77
                     6*****************99**************************************97 PP

2Wus_type_Homeobox1131.6e-361779365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +RW+Pt eQi +Le+ly++G+rtPn+e+iq++t++L++yG+i++kNVfyWFQN+kaR+rqkq
    Vradi04g02170.1 17 VSRWSPTREQIAMLEDLYRQGMRTPNAEQIQEVTSRLRAYGHIQGKNVFYWFQNHKARQRQKQ 79
                       68***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-121385IPR009057Homeodomain-like
PROSITE profilePS5007111.0461378IPR001356Homeobox domain
SMARTSM003891.0E-51582IPR001356Homeobox domain
PfamPF000462.2E-171877IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.2E-81877IPR009057Homeodomain-like
CDDcd000862.85E-41979No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGSRSAIRRE SSRTHSVSRW SPTREQIAML EDLYRQGMRT PNAEQIQEVT SRLRAYGHIQ  60
GKNVFYWFQN HKARQRQKQK LESIAHSNSF LPVSHPICQN VVCAPFYSQQ SGMNFYPQPE  120
KVVAAGGIVG TVVPFGMLKI CDGQQIYQQL RQRVQPDYNI NDKKTLTLFP LHPTGILKEK  180
TANQGSSHAS ASGSH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi04g02170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-139AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014496704.11e-146WUSCHEL-related homeobox 4-like
TrEMBLA0A1S3TSG31e-145A0A1S3TSG3_VIGRR; WUSCHEL-related homeobox 4-like
STRINGGLYMA13G41000.16e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.15e-40WUSCHEL related homeobox 2