PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi04g00170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Trihelix
Protein Properties Length: 234aa    MW: 28789.8 Da    PI: 10.1505
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi04g00170.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix68.11.7e-2191159169
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69 
                      +W+ qe+++ + +r e+++++ ++k++k+lWe +s++m+e+gf+rs++qCk+kw+nl +ryk  ++++ 
  Vradi04g00170.1  91 QWSIQETKEFLVIRAELDQTFMETKRNKQLWEVISNRMKEKGFHRSAEQCKCKWKNLVTRYKMRQQMQM 159
                      7*************************************************************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.51E-2390153No hitNo description
PfamPF138379.4E-1591159No hitNo description
PROSITE profilePS500907.31792148IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
FSFSLSSITK THSSIAFFYI IQSHSFILFY IGFLNLWLSS FGLRFQFFME GRHLHHHHHH  60
RQQQQQQQHQ HHHSHNITTG ANVDATDRFP QWSIQETKEF LVIRAELDQT FMETKRNKQL  120
WEVISNRMKE KGFHRSAEQC KCKWKNLVTR YKMRQQMQME AQWMEAFEAR ENERRMKEME  180
WRQTMEALEN ERMMMDQRWR EREEQRRIRE ELRADKRDAL ITALLNKLTR EQM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497307.12e-51PREDICTED: trihelix transcription factor GT-3b
TrEMBLA0A0S3RUB87e-51A0A0S3RUB8_PHAAN; Uncharacterized protein
STRINGGLYMA18G43190.27e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-33Trihelix family protein