PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0425s00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 248aa    MW: 27845.8 Da    PI: 6.7374
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0425s00040.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.54.1e-4741341127
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                        l pGfrF Pt+eelv +yL++++eg+++++++vi+ ++i+ vePw+Lp+    ++++++++w+fFs+r++++++g r+nr+t+sgyWkatg+
  Vradi0425s00040.1   4 LSPGFRFYPTEEELVAFYLHNQLEGQRHDTSRVIPVIEINGVEPWNLPTlageRCRGDTEQWFFFSPRQEREERGGRPNRTTASGYWKATGS 95 
                        579***************************9****************9546666666888******************************** PP

                NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                          +v+s++++++g+kkt+vfy+g+ap+g+kt+W mhey+
  Vradi0425s00040.1  96 PCHVYSSDNKVIGMKKTMVFYTGKAPSGRKTKWKMHEYK 134
                        **************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-493159IPR003441NAC domain
PROSITE profilePS5100548.3864161IPR003441NAC domain
PfamPF023653.3E-256134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MADLSPGFRF YPTEEELVAF YLHNQLEGQR HDTSRVIPVI EINGVEPWNL PTLAGERCRG  60
DTEQWFFFSP RQEREERGGR PNRTTASGYW KATGSPCHVY SSDNKVIGMK KTMVFYTGKA  120
PSGRKTKWKM HEYKAIQHSH QSNATPPKLR HEFSLCRVYV ISGSFRSFDR RPVEIGRAEL  180
GVDGDRGGGA STSGQERAAM VDGSSSPDDT CHSGEAGEDC NASNRVEEPL WEWEHLIGHD  240
DPYVKHA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-37415920166NAC domain-containing protein 19
3swm_B2e-37415920166NAC domain-containing protein 19
3swm_C2e-37415920166NAC domain-containing protein 19
3swm_D2e-37415920166NAC domain-containing protein 19
3swp_A2e-37415920166NAC domain-containing protein 19
3swp_B2e-37415920166NAC domain-containing protein 19
3swp_C2e-37415920166NAC domain-containing protein 19
3swp_D2e-37415920166NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi0425s00040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-156AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014522668.10.0NAC domain-containing protein 90-like
SwissprotQ9FMR31e-86NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A1S3VWC00.0A0A1S3VWC0_VIGRR; NAC domain-containing protein 90-like
STRINGXP_007150056.11e-146(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-82NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]