PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi03g09620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 655aa    MW: 71247.5 Da    PI: 6.1139
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi03g09620.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.66.9e-29211264155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ eLH++Fv av+qL G ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Vradi03g09620.1 211 KPRVVWSVELHRKFVAAVNQL-GLEKAVPKKILDLMNVEGLTRENVASHLQKYRL 264
                      79*******************.********************************8 PP

2Response_reg85.91.2e-28261341109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+pl +++l+++l+k +y +v+++ ++ eal++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + +  
  Vradi03g09620.1  26 VLAVDDDPLCLKVLENLLRKCQY-QVTTTNQAVEALKMLRENRnkFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMQGVTH 117
                      799********************.***************999889*******************87754.558********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+ +eel +
  Vradi03g09620.1 118 GACDYLLKPVRIEELKN 134
                      **************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.0E-1621652IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.5E-4323157No hitNo description
SuperFamilySSF521727.54E-3723145IPR011006CheY-like superfamily
SMARTSM004484.7E-3524136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011045.26225140IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.6E-2626134IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.76E-3027139No hitNo description
Gene3DG3DSA:1.10.10.602.8E-30208268IPR009057Homeodomain-like
PROSITE profilePS5129411.584208267IPR017930Myb domain
SuperFamilySSF466891.11E-19209268IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-24211264IPR006447Myb domain, plants
PfamPF002491.9E-7213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MAVENQRDHL GDEDGGGDRF PVGMRVLAVD DDPLCLKVLE NLLRKCQYQV TTTNQAVEAL  60
KMLRENRNKF DLVISDVNMP DMDGFKLLEL VGLEMDLPVI MLSAHSDTKL VMQGVTHGAC  120
DYLLKPVRIE ELKNIWQHVV RRKNFDGRDQ SKASNDEKAL NIAGEGSLSL RSENSADQNK  180
RLGKKRKDQS EEEDDDGEGN GDDDDPSAQK KPRVVWSVEL HRKFVAAVNQ LGLEKAVPKK  240
ILDLMNVEGL TRENVASHLQ KYRLYLKKAN HQANMVAALG GSDSYLRMGS IDGFGDFCTA  300
SGSGRISNTT LPSYASSGIF SRLNSPAGLN MRGISSSTLI RPVQTQNINS SLNTLGNIQP  360
SIFSANQSSS LLQGIPTSIE LNQSKQSNCS TGLSQLSQVD SSAYTVASGF PDSRAATVNG  420
PNNSLSCGSN NHIILQGNPQ QTHGPGTFRN QSSVRSASLN AESFGIGGSS NMLDYNRCNK  480
NWQNAAQLSK FPANSSPLCE AFGNDQLPPT SINVSNSGTH IGNSPVDFSS RMAMSVPLED  540
VQPLSYAPQQ RWEEHKLDYD QNLSRPFNPV NPYASSSAAT SSMGHGLNQN NTICSNRINA  600
SLVGPCTDVD KFSSDIPLKS NEAYILEQLK SQEGFMQNTF GTLDDIMGAM VKRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-26207270164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179187KRLGKKRKD
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi03g09620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014496227.10.0two-component response regulator ARR12
SwissprotQ6K8X61e-135ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A1S3TR810.0A0A1S3TR81_VIGRR; Two-component response regulator
STRINGXP_007138266.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-130response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]