PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi03g09040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 306aa    MW: 35882.6 Da    PI: 6.6037
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi03g09040.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.22.5e-26167216352
           RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++s e++s+yF++pi +AAkeL+v+lT LK++CR++GI+RWPhRk+ sl
  Vradi03g09040.1 167 RNLSRETVSQYFYMPISQAAKELNVGLTHLKKRCRELGIQRWPHRKLMSL 216
                      699********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.019152237IPR003035RWP-RK domain
PfamPF020423.4E-22168216IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MENHQLTFWN SNYQIDENSF APTCQFSSYD YFRFFPLLYF STLLSFHVRK SYHVSIFNFC  60
RGNASDGFHW PYEFPLQDSY FDVVPFMKCY YPHDILYETL PLEPTPLSFQ GYYDFSDVKN  120
VLSAWNEVDV SDHKPAFSSS NDGGSVNDTM EEVKGKHREE RISSSARNLS RETVSQYFYM  180
PISQAAKELN VGLTHLKKRC RELGIQRWPH RKLMSLQTLI KNMQEQVESE GPENDEKIRT  240
AIEMLEKEKS SVEQKPDLEL EDKTRRLRQA CFKANYKKRK LMTMRIMEPN LPLLPYPTSI  300
DKGGE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi03g09040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-157AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495091.10.0protein RKD1
TrEMBLA0A1S3TMU60.0A0A1S3TMU6_VIGRR; protein RKD1
STRINGGLYMA06G20881.11e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.19e-54RWP-RK domain-containing protein