PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi03g08960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 279aa    MW: 31139.2 Da    PI: 8.7233
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi03g08960.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM31.26.6e-101640125
              NAM  1 lppGfrFhPtdeelvveyLkkkveg 25
                     lppGfrFhPtdeel+++yL +k++ 
  Vradi03g08960.1 16 LPPGFRFHPTDEELITHYLYRKAKM 40
                     79*******************9875 PP

2NAM112.83.6e-353811551129
              NAM  51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +k +ekewyfF+ rd+ky+tg r+nrat+sgyWkatgkdke+++ +++ vg+kktLvfykgrapkgektdWvmheyrle
  Vradi03g08960.1  38 AKMGEKEWYFFCVRDRKYPTGLRTNRATESGYWKATGKDKEIFR-GKSPVGMKKTLVFYKGRAPKGEKTDWVMHEYRLE 115
                      456899**************************************.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.0861139IPR003441NAC domain
SuperFamilySSF1019411.7E-5214139IPR003441NAC domain
PfamPF023651.5E-2917114IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MENVSVLCKE EVPMDLPPGF RFHPTDEELI THYLYRKAKM GEKEWYFFCV RDRKYPTGLR  60
TNRATESGYW KATGKDKEIF RGKSPVGMKK TLVFYKGRAP KGEKTDWVMH EYRLEGKFSV  120
PNLPKTAKNE WVICRVFQKS SGGKKTHIDG IMMMDSYGNN ELGSSALPPL TDSSPSIGNT  180
KALSVSDQAP PTLPSPGSSN HYLRSFFNNH GKGSFLRNGF EPETEMVSVS QETGVSTEVN  240
AETSSVVSNL EMGNRVFENQ NNPIGSAAPV DLASLWNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-421414515171NO APICAL MERISTEM PROTEIN
1ut4_B8e-421414515171NO APICAL MERISTEM PROTEIN
1ut7_A8e-421414515171NO APICAL MERISTEM PROTEIN
1ut7_B8e-421414515171NO APICAL MERISTEM PROTEIN
3swm_A1e-411414518174NAC domain-containing protein 19
3swm_B1e-411414518174NAC domain-containing protein 19
3swm_C1e-411414518174NAC domain-containing protein 19
3swm_D1e-411414518174NAC domain-containing protein 19
3swp_A1e-411414518174NAC domain-containing protein 19
3swp_B1e-411414518174NAC domain-containing protein 19
3swp_C1e-411414518174NAC domain-containing protein 19
3swp_D1e-411414518174NAC domain-containing protein 19
4dul_A8e-421414515171NAC domain-containing protein 19
4dul_B8e-421414515171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi03g08960.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0287731e-146DQ028773.1 Glycine max NAC domain protein NAC5 (NAC5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495267.10.0NAC domain-containing protein 100
SwissprotQ9FLJ21e-104NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A1S3TNH50.0A0A1S3TNH5_VIGRR; NAC domain-containing protein 100
STRINGXP_007138169.11e-167(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-106NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]