PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi03g07710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 420aa    MW: 45194.6 Da    PI: 8.7878
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi03g07710.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32231284255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Vradi03g07710.1 231 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 284
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15228284IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28229284IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23231284IPR006447Myb domain, plants
PfamPF002497.5E-7232283IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MPLEGIFIEP TSTSTPDLSL HISPPSTSSS SSLICNNGTS GGATNYEARN STSTNFPSQA  60
HTELSLGRNF SGGGRGGIEE PPPHNSNTSI NPYYQTQQPH FHHLHHHSNT GNASKPATAT  120
TTTSSSNHLS HINYGVSLLD VSSEGLRPIK GIPVYHNRGT TVAAAAAYRA ATATRFNGIS  180
GEAFKSHHPL HHHHSSSHYG VGLGGSHEAS SGLMRSRFLP KLPTKRSMRA PRMRWTSTLH  240
ARFVHAVELL GGHERATPKS VLELMDVKDL TLAHVKSHLQ MYRTVKTTDK PAASSGLSDG  300
SGEDDISPMG SSGGMRQFSD QRSLSDRPVQ QDMDYSSANT LWSNSSSNRE LWQQNSSNDI  360
NGFRPPIFQS QQISGGHQIQ DCDSSQLKNS LSGSGNLECK NPSLEFTLGR PDWNGKGQA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16232286357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16232286357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16232286357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16232286357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi03g07710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027336348.10.0transcription repressor KAN1-like
TrEMBLA0A0B2PHI30.0A0A0B2PHI3_GLYSO; Transcription repressor KAN1
STRINGGLYMA18G04880.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-59G2-like family protein